Web Server Statistics for sahyadrimahavidyalaysawarde.ptechinstitute.comProgram started on Sat, Jan 31 2026 at 7:04 AM.
Analyzed requests from Tue, Jul 08 2025 at 3:02 AM to Sat, Jan 31 2026 at 6:31 AM (207.15 days).
(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organization Report | Failed Referrer Report | Referring Site Report | Browser Report | Browser Summary | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)
Figures in parentheses refer to the 7-day period ending Jan 31 2026 at 7:04 AM.
Successful requests: 4,248 (127)
Average successful requests per day: 20 (18)
Successful requests for pages: 843 (15)
Average successful requests for pages per day: 4 (2)
Failed requests: 8,373 (2)
Distinct files requested: 3,418 (6,053)
Distinct hosts served: 555 (696)
Data transferred: 653.83 kilobytes (14.06 kilobytes)
Average data transferred per day: 3.16 kilobytes (2.01 kilobytes)
(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organization Report | Failed Referrer Report | Referring Site Report | Browser Report | Browser Summary | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)
Each unit (
) represents 5 requests for pages or part thereof.
| month | #reqs | #pages | |
|---|---|---|---|
| Jul 2025 | 480 | 76 |  |
| Aug 2025 | 615 | 100 |  |
| Sep 2025 | 620 | 140 |  |
| Oct 2025 | 695 | 194 |   |
| Nov 2025 | 573 | 93 | |
| Dec 2025 | 615 | 94 | |
| Jan 2026 | 650 | 146 | |
Busiest month: Oct 2025 (194 requests for pages).
(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organization Report | Failed Referrer Report | Referring Site Report | Browser Report | Browser Summary | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)
Each unit () represents 4 requests for pages or part thereof.
| day | #reqs | #pages | |
|---|---|---|---|
| Sun | 571 | 101 | |
| Mon | 636 | 172 | |
| Tue | 601 | 108 | |
| Wed | 619 | 119 | |
| Thu | 619 | 126 | |
| Fri | 593 | 105 | |
| Sat | 609 | 112 | |
(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organization Report | Failed Referrer Report | Referring Site Report | Browser Report | Browser Summary | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)
Each unit () represents 2 requests for pages or part thereof.
| hour | #reqs | #pages | |
|---|---|---|---|
| 0 | 452 | 30 | |
| 1 | 54 | 34 | |
| 2 | 66 | 60 | |
| 3 | 472 | 40 | |
| 4 | 38 | 38 | |
| 5 | 44 | 40 | |
| 6 | 445 | 27 | |
| 7 | 40 | 30 | |
| 8 | 30 | 30 | |
| 9 | 447 | 27 | |
| 10 | 47 | 47 | |
| 11 | 50 | 50 | |
| 12 | 454 | 40 | |
| 13 | 37 | 37 | |
| 14 | 17 | 17 | |
| 15 | 444 | 30 | |
| 16 | 22 | 22 | |
| 17 | 29 | 27 | |
| 18 | 470 | 41 | |
| 19 | 38 | 38 | |
| 20 | 35 | 35 | |
| 21 | 461 | 47 | |
| 22 | 29 | 29 | |
| 23 | 27 | 27 | |
(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organization Report | Failed Referrer Report | Referring Site Report | Browser Report | Browser Summary | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)
Listing domains, sorted by the amount of traffic.
| #reqs | %bytes | domain |
|---|---|---|
| 4248 | 100% | [unresolved numerical addresses] |
(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organization Report | Failed Referrer Report | Referring Site Report | Browser Report | Browser Summary | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)
Listing the top 20 organizations by the number of requests, sorted by the number of requests.
| #reqs | %bytes | organization |
|---|---|---|
| 3388 | 32.39% | 216.10 |
| 102 | 6.84% | 34 |
| 77 | 5.30% | 45 |
| 51 | 3.43% | 35 |
| 50 | 3.29% | 54 |
| 48 | 3.20% | 2 |
| 42 | 2.75% | 44 |
| 32 | 2.21% | 199.45 |
| 29 | 1.98% | 198.235 |
| 23 | 1.44% | 18 |
| 21 | 11.83% | 185.177 |
| 21 | 1.43% | 206.168 |
| 21 | 1.41% | 205.210 |
| 20 | 1.36% | 167.94 |
| 18 | 1.20% | 194.26 |
| 16 | 0.85% | 3 |
| 15 | 1.02% | 145.220 |
| 15 | 1.05% | 104 |
| 14 | 0.93% | 52 |
| 10 | 0.68% | 162.142 |
| 235 | 15.40% | [not listed: 93 organizations] |
(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organization Report | Failed Referrer Report | Referring Site Report | Browser Report | Browser Summary | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)
Listing referring URLs, sorted by the number of failed requests.
(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organization Report | Failed Referrer Report | Referring Site Report | Browser Report | Browser Summary | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)
Listing referring sites, sorted by the number of requests.
| #reqs | site |
|---|---|
| 6 | http://sahyadrimahavidyalaysawarde.ptechinstitute.com/ |
| 5 | https://www.google.com/ |
| 1 | https://www.google.es/ |
| 1 | https://www.netcraft.com/ |
(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organization Report | Failed Referrer Report | Referring Site Report | Browser Report | Browser Summary | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)
Listing the top 40 browsers by the number of requests for pages, sorted by the number of requests for pages.
| #reqs | #pages | browser |
|---|---|---|
| 123 | 123 | Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/78.0.3904.108 Safari/537.36 |
| 89 | 89 | Mozilla/5.0 (compatible; CensysInspect/1.1; +https://about.censys.io/) |
| 47 | 47 | Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_7) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/113.0.0.0 Safari/537.36 |
| 44 | 44 | Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/70.0.3538.102 Safari/537.36 Edge/18.19582 |
| 41 | 41 | Mozilla/5.0 (Linux; Android 8.0.0; SM-G965U Build/R16NW) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/63.0.3239.111 Mobile Safari/537.36 |
| 37 | 37 | Mozilla/5.0 (iPhone; CPU iPhone OS 14_4 like Mac OS X) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/15.4 Mobile/15E148 Safari/604.1 |
| 33 | 33 | Mozilla/5.0 (Windows NT 6.1; Win64; x64; rv:47.0) Gecko/20100101 Firefox/47.0 |
| 30 | 30 | Mozilla/5.0 (compatible; CMS-Checker/1.0; +https://example.com) |
| 29 | 29 | Hello from Palo Alto Networks, find out more about our scans in https://docs-cortex.paloaltonetworks.com/r/1/Cortex-Xpanse/Scanning-activity |
| 25 | 25 | Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_7) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/135.0.0.0 Safari/537.36 |
| 18 | 18 | Mozilla/5.0 (X11; Linux x86_64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/139.0.0.0 Safari/537.36 |
| 15 | 15 | Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/88.0.4240.193 Safari/537.36 |
| 15 | 15 | Mozilla/5.0 (Macintosh; Intel Mac OS X 10.15; rv:122.0) Gecko/20100101 Firefox/122.0 |
| 13 | 13 | Go-http-client/1.1 |
| 11 | 11 | Mozilla/5.0 (compatible; InternetMeasurement/1.0; +https://internet-measurement.com/) |
| 10 | 10 | python-httpx/0.28.1 |
| 9 | 9 | curl/7.61.1 |
| 11 | 9 | Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/91.0.4472.124 Safari/537.36 |
| 8 | 8 | Mozilla/5.0 (X11; Linux x86_64; rv:139.0) Gecko/20100101 Firefox/139.0 |
| 8 | 8 | Mozilla/5.0 (iPhone; CPU iPhone OS 14_6 like Mac OS X) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/14.0.3 Mobile/15E148 Safari/604.1 |
| 7 | 7 | Mozilla/5.0 (X11; Linux x86_64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/137.0.0.0 Safari/537.36 |
| 7 | 7 | Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 |
| 7 | 7 | socketburst/0.1 |
| 6 | 6 | Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/58.0.3029.110 Safari/537.3 |
| 6 | 6 | Mozilla/5.0 (compatible; NetcraftSurveyAgent/1.0; +info@netcraft.com) |
| 6 | 6 | Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/93.0.4577.63 Safari/537.36 |
| 6 | 6 | Mozilla/5.0 (Macintosh; Intel Mac OS X 10_10_1) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/39.0.2171.95 Safari/537.36 |
| 5 | 5 | Mozilla/5.0 (Windows NT 6.1) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/71.0.2623.112 Safari/537.36 |
| 5 | 5 | cypex.ai/scanning Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_7) Chrome/126.0.0.0 Safari/537.36 |
| 20 | 5 | Mozilla/5.0 (compatible; Let's Encrypt validation server; +https://www.letsencrypt.org) |
| 5 | 5 | Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.0.0 Safari/537.36 Edg/114.0.1823.43 |
| 5 | 5 | Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/95.0.4638.69 Safari/537.36 |
| 4 | 4 | Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/104.0.0.0 Safari/537.36 |
| 4 | 4 | Mozilla/5.0 (Windows NT 6.1; WOW64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/63.0.3239.132 Safari/537.36 QIHU 360SE |
| 3 | 3 | Mozilla/5.0 zgrab/0.x |
| 3 | 3 | Mozilla/5.0 (X11; Linux x86_64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/142.0.0.0 Safari/537.36 |
| 2 | 2 | Mozilla/5.0 (l9scan/2.0.7343e2334323e20313e2631323; +https://leakix.net) |
| 2 | 2 | Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 Chrome/121.0.0.0 |
| 2 | 2 | Mozilla/5.0 (Linux; Android 5.1.1; SM-J111F) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/73.0.3683.90 Mobile Safari/537.36 |
| 2 | 2 | Mozilla/5.0 (Windows NT 5.1; WOW64) Gecko/20101605 Firefox/22.0 |
| 3452 | 64 | [not listed: 60 browsers] |
(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organization Report | Failed Referrer Report | Referring Site Report | Browser Report | Browser Summary | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)
Listing browsers with at least 1 request for a page, sorted by the number of requests for pages.
| # | #reqs | #pages | browser |
|---|---|---|---|
| 1 | 469 | 467 | Safari |
| 422 | 420 | Safari/537 | |
| 45 | 45 | Safari/604 | |
| 2 | 2 | Safari/605 | |
| 2 | 157 | 142 | Netscape (compatible) |
| 3 | 71 | 71 | Firefox |
| 33 | 33 | Firefox/47 | |
| 15 | 15 | Firefox/122 | |
| 8 | 8 | Firefox/139 | |
| 2 | 2 | Firefox/22 | |
| 2 | 2 | Firefox/121 | |
| 2 | 2 | Firefox/142 | |
| 2 | 2 | Firefox/117 | |
| 1 | 1 | Firefox/53 | |
| 1 | 1 | Firefox/19 | |
| 1 | 1 | Firefox/123 | |
| 4 | 29 | 29 | Hello from Palo Alto Networks, find out more about our scans in https: |
| 29 | 29 | Hello from Palo Alto Networks, find out more about our scans in https://docs-cortex | |
| 5 | 22 | 22 | Mozilla |
| 6 | 13 | 13 | Go-http-client |
| 13 | 13 | Go-http-client/1 | |
| 7 | 10 | 10 | python-httpx |
| 10 | 10 | python-httpx/0 | |
| 8 | 9 | 9 | curl |
| 9 | 9 | curl/7 | |
| 9 | 7 | 7 | socketburst |
| 7 | 7 | socketburst/0 | |
| 3388 | 0 | [not listed: 1 browser] |
(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organization Report | Failed Referrer Report | Referring Site Report | Browser Report | Browser Summary | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)
Listing operating systems, sorted by the number of requests for pages.
| # | #reqs | #pages | OS |
|---|---|---|---|
| 1 | 299 | 297 | Windows |
| 249 | 247 | Windows NT | |
| 47 | 47 | Unknown Windows | |
| 3 | 3 | Windows XP | |
| 2 | 3620 | 217 | OS unknown |
| 3 | 160 | 160 | Macintosh |
| 4 | 96 | 96 | Unix |
| 95 | 95 | Linux | |
| 1 | 1 | Other Unix |
(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organization Report | Failed Referrer Report | Referring Site Report | Browser Report | Browser Summary | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)
Listing status codes, sorted numerically.
| #reqs | status code |
|---|---|
| 4246 | 200 OK |
| 2 | 206 Partial content |
| 8373 | 404 Document not found |
(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organization Report | Failed Referrer Report | Referring Site Report | Browser Report | Browser Summary | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)
| size | #reqs | %bytes |
|---|---|---|
| 0 | 8 | |
| 1B- 10B | 0 | |
| 11B- 100B | 3403 | 32.58% |
| 101B- 1kB | 835 | 57.00% |
| 1kB- 10kB | 0 | |
| 10kB-100kB | 2 | 10.42% |
(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organization Report | Failed Referrer Report | Referring Site Report | Browser Report | Browser Summary | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)
Listing extensions with at least 0.1% of the traffic, sorted by the amount of traffic.
| #reqs | %bytes | extension |
|---|---|---|
| 843 | 57.00% | [directories] |
| 3405 | 43.00% | [no extension] |
(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organization Report | Failed Referrer Report | Referring Site Report | Browser Report | Browser Summary | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)
Listing directories with at least 0.01% of the traffic, sorted by the amount of traffic.
| #reqs | %bytes | directory |
|---|---|---|
| 842 | 67.05% | [root directory] |
| 3406 | 32.95% | /.well-known/ |
(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organization Report | Failed Referrer Report | Referring Site Report | Browser Report | Browser Summary | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)
Listing files with at least 20 requests, sorted by the number of requests.
| #reqs | %bytes | last time | file |
|---|---|---|---|
| 840 | 56.64% | Jan/30/26 5:34 PM | / |
| 3408 | 43.36% | Jan/31/26 6:31 AM | [not listed: 3,394 files] |