Web Server Statistics for sahyadrimahavidyalaysawarde.ptechinstitute.com

Program started on Fri, Oct 31 2025 at 8:08 AM.
Analyzed requests from Tue, Jul 08 2025 at 3:02 AM to Fri, Oct 31 2025 at 6:32 AM (115.15 days).

General Summary

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organization Report | Failed Referrer Report | Referring Site Report | Browser Report | Browser Summary | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

Figures in parentheses refer to the 7-day period ending Oct 31 2025 at 8:08 AM.

Successful requests: 2,394 (198)
Average successful requests per day: 20 (28)
Successful requests for pages: 504 (81)
Average successful requests for pages per day: 4 (11)
Failed requests: 2,687 (53)
Distinct files requested: 1,892 (2,976)
Distinct hosts served: 352 (414)
Data transferred: 405.81 kilobytes (42.78 kilobytes)
Average data transferred per day: 3.52 kilobytes (6.11 kilobytes)

Monthly Report

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organization Report | Failed Referrer Report | Referring Site Report | Browser Report | Browser Summary | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

Each unit (+) represents 5 requests for pages or part thereof.

month#reqs#pages 
Jul 202548076++++++++++++++++
Aug 2025615100++++++++++++++++++++
Sep 2025620140++++++++++++++++++++++++++++
Oct 2025679188++++++++++++++++++++++++++++++++++++++

Busiest month: Oct 2025 (188 requests for pages).

Daily Summary

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organization Report | Failed Referrer Report | Referring Site Report | Browser Report | Browser Summary | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

Each unit (+) represents 2 requests for pages or part thereof.

day#reqs#pages 
Sun32365+++++++++++++++++++++++++++++++++
Mon33983++++++++++++++++++++++++++++++++++++++++++
Tue34565+++++++++++++++++++++++++++++++++
Wed35472++++++++++++++++++++++++++++++++++++
Thu36988++++++++++++++++++++++++++++++++++++++++++++
Fri32862+++++++++++++++++++++++++++++++
Sat33669+++++++++++++++++++++++++++++++++++

Hourly Summary

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organization Report | Failed Referrer Report | Referring Site Report | Browser Report | Browser Summary | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

Each unit (+) represents 1 request for a page.

hour#reqs#pages 
024717+++++++++++++++++
12618++++++++++++++++++
23535+++++++++++++++++++++++++++++++++++
326224++++++++++++++++++++++++
41717+++++++++++++++++
52321+++++++++++++++++++++
625117+++++++++++++++++
72818++++++++++++++++++
82222++++++++++++++++++++++
925721+++++++++++++++++++++
102323+++++++++++++++++++++++
113636++++++++++++++++++++++++++++++++++++
1225929+++++++++++++++++++++++++++++
132424++++++++++++++++++++++++
141010++++++++++
1524313+++++++++++++
1688++++++++
172321+++++++++++++++++++++
1826525+++++++++++++++++++++++++
192222++++++++++++++++++++++
202525+++++++++++++++++++++++++
2124515+++++++++++++++
222424++++++++++++++++++++++++
231919+++++++++++++++++++

Domain Report

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organization Report | Failed Referrer Report | Referring Site Report | Browser Report | Browser Summary | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

Listing domains, sorted by the amount of traffic.

#reqs%bytesdomain
2394100%[unresolved numerical addresses]

Organization Report

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organization Report | Failed Referrer Report | Referring Site Report | Browser Report | Browser Summary | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

Listing the top 20 organizations by the number of requests, sorted by the number of requests.

#reqs%bytesorganization
187828.92%216.10
79 8.41%34
45 4.84%2
38 4.00%54
36 3.87%35
35 3.76%44
25 2.69%45
18 1.94%194.26
15 1.61%205.210
1418.16%185.177
14 1.51%199.45
13 1.31%18
13 1.40%206.168
13 1.40%198.235
12 1.29%167.94
11 1.18%52
10 1.08%145.220
10 0.71%3
6 0.65%209.38
6 0.65%162.142
10310.63%[not listed: 58 organizations]

Failed Referrer Report

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organization Report | Failed Referrer Report | Referring Site Report | Browser Report | Browser Summary | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

Listing referring URLs, sorted by the number of failed requests.

#reqsURL
39http://sahyadrimahavidyalaysawarde.ptechinstitute.com/
11http://www.sahyadrimahavidyalaysawarde.ptechinstitute.com/
2https://www.google.com/

Referring Site Report

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organization Report | Failed Referrer Report | Referring Site Report | Browser Report | Browser Summary | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

Listing referring sites, sorted by the number of requests.

#reqssite
6http://sahyadrimahavidyalaysawarde.ptechinstitute.com/
3https://www.google.com/
1https://www.google.es/
1https://www.netcraft.com/

Browser Report

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organization Report | Failed Referrer Report | Referring Site Report | Browser Report | Browser Summary | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

Listing the top 40 browsers by the number of requests for pages, sorted by the number of requests for pages.

#reqs#pagesbrowser
9999Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/78.0.3904.108 Safari/537.36
4747Mozilla/5.0 (compatible; CensysInspect/1.1; +https://about.censys.io/)
3939Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_7) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/113.0.0.0 Safari/537.36
3333Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/70.0.3538.102 Safari/537.36 Edge/18.19582
3131Mozilla/5.0 (Linux; Android 8.0.0; SM-G965U Build/R16NW) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/63.0.3239.111 Mobile Safari/537.36
3030Mozilla/5.0 (iPhone; CPU iPhone OS 14_4 like Mac OS X) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/15.4 Mobile/15E148 Safari/604.1
2525Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_7) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/135.0.0.0 Safari/537.36
1616Hello from Palo Alto Networks, find out more about our scans in https://docs-cortex.paloaltonetworks.com/r/1/Cortex-Xpanse/Scanning-activity
1515Mozilla/5.0 (compatible; CMS-Checker/1.0; +https://example.com)
1111Mozilla/5.0 (X11; Linux x86_64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/139.0.0.0 Safari/537.36
1010Mozilla/5.0 (Macintosh; Intel Mac OS X 10.15; rv:122.0) Gecko/20100101 Firefox/122.0
99Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/88.0.4240.193 Safari/537.36
119Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/91.0.4472.124 Safari/537.36
88python-httpx/0.28.1
77Mozilla/5.0 (compatible; InternetMeasurement/1.0; +https://internet-measurement.com/)
66Mozilla/5.0 (iPhone; CPU iPhone OS 14_6 like Mac OS X) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/14.0.3 Mobile/15E148 Safari/604.1
55Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.0.0 Safari/537.36 Edg/114.0.1823.43
55Mozilla/5.0 (X11; Linux x86_64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/137.0.0.0 Safari/537.36
55Mozilla/5.0 (Macintosh; Intel Mac OS X 10_10_1) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/39.0.2171.95 Safari/537.36
55Go-http-client/1.1
44Mozilla/5.0 (X11; Linux x86_64; rv:139.0) Gecko/20100101 Firefox/139.0
44Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/58.0.3029.110 Safari/537.3
33Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/104.0.0.0 Safari/537.36
33Mozilla/5.0 (Windows NT 6.1) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/71.0.2623.112 Safari/537.36
33Mozilla/5.0 (compatible; NetcraftSurveyAgent/1.0; +info@netcraft.com)
33Mozilla/5.0 zgrab/0.x
22Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/93.0.4577.63 Safari/537.36
22Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 Chrome/121.0.0.0
22Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36
22Mozilla/5.0 (Linux; Android 5.1.1; SM-J111F) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/73.0.3683.90 Mobile Safari/537.36
22Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/117.0.5938.132 Safari/537.36
22Mozilla/5.0 (Windows NT 6.1; WOW64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/63.0.3239.132 Safari/537.36 QIHU 360SE
22Mozilla/5.0 (Linux; Android 6.0; HTC One M9 Build/MRA599705) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/52.0.3624.98 Mobile Safari/537.3
11Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/134.0.0.0 Safari/537.36 Edg/134.0.0.0
11Mozilla/5.0 (Linux; Android 5.1.1; SM-J111F)
11Mozilla/5.0 (Windows NT 6.1; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/60.0.3112.113 Safari/537.36
11Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/71.0.3578.98 Safari/537.36
11Mozilla/5.0 (Windows NT 10.0; Win64; x64; rv:123.0) Gecko/20100101 Firefox/123.0
11Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_7) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/116.0.5845.96 Safari/537.36
11Mozilla/5.0 (Linux; Android 9; Redmi Note 7) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/76.0.3809.111 Mobile Safari/537.36
191123[not listed: 25 browsers]

Browser Summary

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organization Report | Failed Referrer Report | Referring Site Report | Browser Report | Browser Summary | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

Listing browsers with at least 1 request for a page, sorted by the number of requests for pages.

##reqs#pagesbrowser
1349347Safari
 313311  Safari/537
 3636  Safari/604
28373Netscape (compatible)
32020Firefox
 1010  Firefox/122
 44  Firefox/139
 11  Firefox/121
 11  Firefox/123
 11  Firefox/125
 11  Firefox/126
 11  Firefox/127
 11  Firefox/19
41616Hello from Palo Alto Networks, find out more about our scans in https:
 1616  Hello from Palo Alto Networks, find out more about our scans in https://docs-cortex
51010Mozilla
688python-httpx
 88  python-httpx/0
755Go-http-client
 55  Go-http-client/1
 18780[not listed: 1 browser]

Operating System Report

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organization Report | Failed Referrer Report | Referring Site Report | Browser Report | Browser Summary | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

Listing operating systems, sorted by the number of requests for pages.

##reqs#pagesOS
1191189Windows
 182180  Windows NT
 99  Unknown Windows
2123123Macintosh
31994106OS unknown
46161Unix
 6161  Linux

Status Code Report

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organization Report | Failed Referrer Report | Referring Site Report | Browser Report | Browser Summary | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

Listing status codes, sorted numerically.

#reqsstatus code
2394200 OK
2687404 Document not found

File Size Report

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organization Report | Failed Referrer Report | Referring Site Report | Browser Report | Browser Summary | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

size#reqs%bytes
02 
1B- 10B0 
11B- 100B188829.13%
101B- 1kB50254.08%
1kB- 10kB0 
10kB-100kB216.78%

File Type Report

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organization Report | Failed Referrer Report | Referring Site Report | Browser Report | Browser Summary | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

Listing extensions with at least 0.1% of the traffic, sorted by the amount of traffic.

#reqs%bytesextension
50454.08%[directories]
189045.92%[no extension]

Directory Report

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organization Report | Failed Referrer Report | Referring Site Report | Browser Report | Browser Summary | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

Listing directories with at least 0.01% of the traffic, sorted by the amount of traffic.

#reqs%bytesdirectory
50570.68%[root directory]
188929.32%/.well-known/

Request Report

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organization Report | Failed Referrer Report | Referring Site Report | Browser Report | Browser Summary | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

Listing files with at least 20 requests, sorted by the number of requests.

#reqs%byteslast timefile
50353.89%Oct/31/25 6:32 AM/
189146.11%Oct/31/25 6:31 AM[not listed: 1,883 files]

This analysis was produced by analog 6.0.
Running time: 1 second.

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organization Report | Failed Referrer Report | Referring Site Report | Browser Report | Browser Summary | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)