Web Server Statistics for sahyadrimahavidyalaysawarde.ptechinstitute.comProgram started on Tue, Feb 24 2026 at 7:15 AM.
Analyzed requests from Tue, Jul 08 2025 at 3:02 AM to Mon, Feb 23 2026 at 10:28 AM (230.31 days).
(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organization Report | Failed Referrer Report | Referring Site Report | Browser Report | Browser Summary | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)
Figures in parentheses refer to the 7-day period ending Feb 24 2026 at 7:15 AM.
Successful requests: 4,469 (3)
Average successful requests per day: 19 (0)
Successful requests for pages: 890 (3)
Average successful requests for pages per day: 3 (0)
Failed requests: 8,963 (1)
Distinct files requested: 3,592 (6,340)
Distinct hosts served: 582 (732)
Data transferred: 686.83 kilobytes (1.41 kilobytes)
Average data transferred per day: 2.98 kilobytes (206 bytes)
(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organization Report | Failed Referrer Report | Referring Site Report | Browser Report | Browser Summary | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)
Each unit (
) represents 5 requests for pages or part thereof.
| month | #reqs | #pages | |
|---|---|---|---|
| Jul 2025 | 480 | 76 |  |
| Aug 2025 | 615 | 100 |  |
| Sep 2025 | 620 | 140 |  |
| Oct 2025 | 695 | 194 |   |
| Nov 2025 | 573 | 93 | |
| Dec 2025 | 615 | 94 | |
| Jan 2026 | 665 | 151 | |
| Feb 2026 | 206 | 42 | |
Busiest month: Oct 2025 (194 requests for pages).
(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organization Report | Failed Referrer Report | Referring Site Report | Browser Report | Browser Summary | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)
Each unit () represents 5 requests for pages or part thereof.
| day | #reqs | #pages | |
|---|---|---|---|
| Sun | 612 | 110 | |
| Mon | 679 | 183 | |
| Tue | 640 | 115 | |
| Wed | 645 | 125 | |
| Thu | 637 | 128 | |
| Fri | 612 | 108 | |
| Sat | 644 | 121 | |
(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organization Report | Failed Referrer Report | Referring Site Report | Browser Report | Browser Summary | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)
Each unit () represents 2 requests for pages or part thereof.
| hour | #reqs | #pages | |
|---|---|---|---|
| 0 | 474 | 30 | |
| 1 | 57 | 37 | |
| 2 | 69 | 63 | |
| 3 | 494 | 40 | |
| 4 | 40 | 40 | |
| 5 | 47 | 43 | |
| 6 | 466 | 28 | |
| 7 | 42 | 32 | |
| 8 | 33 | 33 | |
| 9 | 470 | 28 | |
| 10 | 55 | 55 | |
| 11 | 52 | 52 | |
| 12 | 476 | 40 | |
| 13 | 37 | 37 | |
| 14 | 17 | 17 | |
| 15 | 471 | 35 | |
| 16 | 24 | 24 | |
| 17 | 31 | 29 | |
| 18 | 494 | 43 | |
| 19 | 42 | 42 | |
| 20 | 36 | 36 | |
| 21 | 483 | 47 | |
| 22 | 30 | 30 | |
| 23 | 29 | 29 | |
(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organization Report | Failed Referrer Report | Referring Site Report | Browser Report | Browser Summary | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)
Listing domains, sorted by the amount of traffic.
| #reqs | %bytes | domain |
|---|---|---|
| 4469 | 100% | [unresolved numerical addresses] |
(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organization Report | Failed Referrer Report | Referring Site Report | Browser Report | Browser Summary | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)
Listing the top 20 organizations by the number of requests, sorted by the number of requests.
| #reqs | %bytes | organization |
|---|---|---|
| 3562 | 32.41% | 216.10 |
| 103 | 6.58% | 34 |
| 77 | 5.05% | 45 |
| 51 | 3.26% | 35 |
| 50 | 3.14% | 54 |
| 48 | 3.05% | 2 |
| 42 | 2.62% | 44 |
| 32 | 2.10% | 199.45 |
| 29 | 1.88% | 198.235 |
| 24 | 1.62% | 104 |
| 23 | 1.50% | 206.168 |
| 23 | 1.37% | 18 |
| 22 | 1.41% | 205.210 |
| 21 | 11.26% | 185.177 |
| 20 | 1.29% | 167.94 |
| 18 | 1.14% | 194.26 |
| 18 | 1.19% | 162.142 |
| 16 | 0.81% | 3 |
| 15 | 0.97% | 145.220 |
| 14 | 0.89% | 52 |
| 261 | 16.45% | [not listed: 98 organizations] |
(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organization Report | Failed Referrer Report | Referring Site Report | Browser Report | Browser Summary | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)
Listing referring URLs, sorted by the number of failed requests.
(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organization Report | Failed Referrer Report | Referring Site Report | Browser Report | Browser Summary | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)
Listing referring sites, sorted by the number of requests.
| #reqs | site |
|---|---|
| 6 | http://sahyadrimahavidyalaysawarde.ptechinstitute.com/ |
| 5 | https://www.google.com/ |
| 1 | https://www.google.es/ |
| 1 | https://www.netcraft.com/ |
(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organization Report | Failed Referrer Report | Referring Site Report | Browser Report | Browser Summary | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)
Listing the top 40 browsers by the number of requests for pages, sorted by the number of requests for pages.
| #reqs | #pages | browser |
|---|---|---|
| 123 | 123 | Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/78.0.3904.108 Safari/537.36 |
| 99 | 99 | Mozilla/5.0 (compatible; CensysInspect/1.1; +https://about.censys.io/) |
| 47 | 47 | Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_7) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/113.0.0.0 Safari/537.36 |
| 44 | 44 | Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/70.0.3538.102 Safari/537.36 Edge/18.19582 |
| 41 | 41 | Mozilla/5.0 (Linux; Android 8.0.0; SM-G965U Build/R16NW) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/63.0.3239.111 Mobile Safari/537.36 |
| 37 | 37 | Mozilla/5.0 (iPhone; CPU iPhone OS 14_4 like Mac OS X) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/15.4 Mobile/15E148 Safari/604.1 |
| 33 | 33 | Mozilla/5.0 (Windows NT 6.1; Win64; x64; rv:47.0) Gecko/20100101 Firefox/47.0 |
| 31 | 31 | Hello from Palo Alto Networks, find out more about our scans in https://docs-cortex.paloaltonetworks.com/r/1/Cortex-Xpanse/Scanning-activity |
| 30 | 30 | Mozilla/5.0 (compatible; CMS-Checker/1.0; +https://example.com) |
| 25 | 25 | Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_7) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/135.0.0.0 Safari/537.36 |
| 18 | 18 | curl/7.61.1 |
| 18 | 18 | Mozilla/5.0 (X11; Linux x86_64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/139.0.0.0 Safari/537.36 |
| 16 | 16 | Go-http-client/1.1 |
| 15 | 15 | Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/88.0.4240.193 Safari/537.36 |
| 15 | 15 | Mozilla/5.0 (Macintosh; Intel Mac OS X 10.15; rv:122.0) Gecko/20100101 Firefox/122.0 |
| 13 | 13 | Mozilla/5.0 (compatible; InternetMeasurement/1.0; +https://internet-measurement.com/) |
| 10 | 10 | python-httpx/0.28.1 |
| 11 | 9 | Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/91.0.4472.124 Safari/537.36 |
| 8 | 8 | Mozilla/5.0 (X11; Linux x86_64; rv:139.0) Gecko/20100101 Firefox/139.0 |
| 8 | 8 | Mozilla/5.0 (iPhone; CPU iPhone OS 14_6 like Mac OS X) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/14.0.3 Mobile/15E148 Safari/604.1 |
| 7 | 7 | Mozilla/5.0 (X11; Linux x86_64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/137.0.0.0 Safari/537.36 |
| 7 | 7 | Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 |
| 7 | 7 | socketburst/0.1 |
| 6 | 6 | Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/58.0.3029.110 Safari/537.3 |
| 6 | 6 | Mozilla/5.0 (compatible; NetcraftSurveyAgent/1.0; +info@netcraft.com) |
| 6 | 6 | Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/93.0.4577.63 Safari/537.36 |
| 6 | 6 | Mozilla/5.0 (Macintosh; Intel Mac OS X 10_10_1) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/39.0.2171.95 Safari/537.36 |
| 5 | 5 | Mozilla/5.0 (Windows NT 6.1) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/71.0.2623.112 Safari/537.36 |
| 5 | 5 | cypex.ai/scanning Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_7) Chrome/126.0.0.0 Safari/537.36 |
| 5 | 5 | Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.0.0 Safari/537.36 Edg/114.0.1823.43 |
| 20 | 5 | Mozilla/5.0 (compatible; Let's Encrypt validation server; +https://www.letsencrypt.org) |
| 5 | 5 | Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/95.0.4638.69 Safari/537.36 |
| 4 | 4 | Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/104.0.0.0 Safari/537.36 |
| 4 | 4 | Mozilla/5.0 (X11; Linux x86_64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/142.0.0.0 Safari/537.36 |
| 4 | 4 | Mozilla/5.0 (Windows NT 6.1; WOW64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/63.0.3239.132 Safari/537.36 QIHU 360SE |
| 3 | 3 | Mozilla/5.0 zgrab/0.x |
| 3 | 3 | Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/80.0.3987.149 Safari/537.36 |
| 3 | 3 | Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/117.0.5938.132 Safari/537.36 |
| 2 | 2 | Mozilla/5.0 (l9scan/2.0.7343e2334323e20313e2631323; +https://leakix.net) |
| 2 | 2 | Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/79.0.3945.79 Safari/537.36 |
| 3643 | 81 | [not listed: 71 browsers] |
(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organization Report | Failed Referrer Report | Referring Site Report | Browser Report | Browser Summary | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)
Listing browsers with at least 1 request for a page, sorted by the number of requests for pages.
| # | #reqs | #pages | browser |
|---|---|---|---|
| 1 | 486 | 484 | Safari |
| 437 | 435 | Safari/537 | |
| 45 | 45 | Safari/604 | |
| 4 | 4 | Safari/605 | |
| 2 | 169 | 154 | Netscape (compatible) |
| 3 | 74 | 74 | Firefox |
| 33 | 33 | Firefox/47 | |
| 15 | 15 | Firefox/122 | |
| 8 | 8 | Firefox/139 | |
| 4 | 4 | Firefox/117 | |
| 2 | 2 | Firefox/22 | |
| 2 | 2 | Firefox/121 | |
| 2 | 2 | Firefox/142 | |
| 1 | 1 | Firefox/53 | |
| 1 | 1 | Firefox/19 | |
| 1 | 1 | Firefox/88 | |
| 4 | 31 | 31 | Hello from Palo Alto Networks, find out more about our scans in https: |
| 31 | 31 | Hello from Palo Alto Networks, find out more about our scans in https://docs-cortex | |
| 5 | 22 | 22 | Mozilla |
| 6 | 18 | 18 | curl |
| 18 | 18 | curl/7 | |
| 7 | 16 | 16 | Go-http-client |
| 16 | 16 | Go-http-client/1 | |
| 8 | 10 | 10 | python-httpx |
| 10 | 10 | python-httpx/0 | |
| 9 | 7 | 7 | socketburst |
| 7 | 7 | socketburst/0 | |
| 3562 | 0 | [not listed: 1 browser] |
(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organization Report | Failed Referrer Report | Referring Site Report | Browser Report | Browser Summary | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)
Listing operating systems, sorted by the number of requests for pages.
| # | #reqs | #pages | OS |
|---|---|---|---|
| 1 | 312 | 310 | Windows |
| 261 | 259 | Windows NT | |
| 48 | 48 | Unknown Windows | |
| 3 | 3 | Windows XP | |
| 2 | 3821 | 244 | OS unknown |
| 3 | 162 | 162 | Macintosh |
| 4 | 100 | 100 | Unix |
| 99 | 99 | Linux | |
| 1 | 1 | Other Unix |
(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organization Report | Failed Referrer Report | Referring Site Report | Browser Report | Browser Summary | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)
Listing status codes, sorted numerically.
| #reqs | status code |
|---|---|
| 4467 | 200 OK |
| 2 | 206 Partial content |
| 8963 | 404 Document not found |
(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organization Report | Failed Referrer Report | Referring Site Report | Browser Report | Browser Summary | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)
| size | #reqs | %bytes |
|---|---|---|
| 0 | 8 | |
| 1B- 10B | 0 | |
| 11B- 100B | 3577 | 32.60% |
| 101B- 1kB | 882 | 57.48% |
| 1kB- 10kB | 0 | |
| 10kB-100kB | 2 | 9.92% |
(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organization Report | Failed Referrer Report | Referring Site Report | Browser Report | Browser Summary | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)
Listing extensions with at least 0.1% of the traffic, sorted by the amount of traffic.
| #reqs | %bytes | extension |
|---|---|---|
| 890 | 57.48% | [directories] |
| 3579 | 42.52% | [no extension] |
(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organization Report | Failed Referrer Report | Referring Site Report | Browser Report | Browser Summary | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)
Listing directories with at least 0.01% of the traffic, sorted by the amount of traffic.
| #reqs | %bytes | directory |
|---|---|---|
| 889 | 67.05% | [root directory] |
| 3580 | 32.95% | /.well-known/ |
(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organization Report | Failed Referrer Report | Referring Site Report | Browser Report | Browser Summary | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)
Listing files with at least 20 requests, sorted by the number of requests.
| #reqs | %bytes | last time | file |
|---|---|---|---|
| 887 | 57.14% | Feb/23/26 10:28 AM | / |
| 11 | 0.75% | Feb/23/26 10:28 AM | /?45.148.10.160 |
| 11 | 0.72% | Feb/22/26 10:45 AM | /?45.148.10.159 |
| 3582 | 42.86% | Feb/11/26 3:31 AM | [not listed: 3,568 files] |