AWSTATS DATA FILE 7.8 (build 20200416) # If you remove this file, all statistics for date 202401 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/awstats.testsahyadrimahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2041 POS_TIME 2720 POS_VISITOR 9401 POS_DAY 10318 POS_DOMAIN 3330 POS_LOGIN 3629 POS_ROBOT 3784 POS_WORMS 4032 POS_EMAILSENDER 4163 POS_EMAILRECEIVER 4306 POS_SESSION 10762 POS_SIDER 10930 POS_FILETYPES 4441 POS_DOWNLOADS 4574 POS_OS 4622 POS_BROWSER 4755 POS_SCREENSIZE 5007 POS_UNKNOWNREFERER 5081 POS_UNKNOWNREFERERBROWSER 5707 POS_ORIGIN 6242 POS_SEREFERRALS 6375 POS_PAGEREFS 6519 POS_SEARCHWORDS 6708 POS_KEYWORDS 6860 POS_MISC 2383 POS_ERRORS 6919 POS_CLUSTER 3485 POS_SIDER_404 7050 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20240201020844 11 3006 13481043740798 FirstTime 20240101090838 LastTime 20240131214713 LastUpdate 20240201182327 11 0 10 0 0 TotalVisits 38 TotalUnique 21 MonthHostsKnown 0 MonthHostsUnknown 21 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 PDFSupport 0 0 0 AddToFavourites 0 16 0 WindowsMediaPlayerSupport 0 0 0 FlashSupport 0 0 0 DirectorSupport 0 0 0 TotalMisc 0 0 0 JavascriptDisabled 0 0 0 RealPlayerSupport 0 0 0 QuickTimeSupport 0 0 0 JavaEnabled 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 2 2 280 8 8 53783 1 2 2 529826 1 1 83 2 5 17 5803994 6 6 390436 3 0 0 0 1 1 83 4 3 4 95793 2 4 166 5 0 0 0 1 1 83 6 0 0 0 4 4 390394 7 7 7 780540 58 58 1427224 8 3 3 390270 29 29 1035638 9 9 11 581300 0 28 354403 10 5 8 478507 0 2 0 11 0 0 0 4 4 390270 12 0 0 0 0 0 0 13 0 0 0 0 0 0 14 1 1 0 2 2 0 15 7 15 3001627 6 10 454596 16 8 8 1671874 2 4 0 17 0 0 0 0 0 0 18 0 0 0 0 0 0 19 2 2 529826 0 0 0 20 1 1 0 2 2 0 21 5 6 95631 2 10 154424 22 5 5 390270 34 34 197112 23 1 1 0 6 6 332 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 6 us 45 64 7536891 ca 12 12 3030400 cn 4 5 485785 in 2 9 2906112 nl 2 2 390270 au 1 1 280 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 3 Go\-http\-client/ 16 5104 20240107073805 0 no_user_agent 15 2926941 20240121064608 0 unknown 4 520 20240131214619 4 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 4 php 23 0 0 0 png 9 337493 0 0 html 43 5580442 0 0 jpg 18 8431803 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 0 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 5 Unknown 44 37 win7 5 4 win10 31 12 androidmarshmallow 8 8 linux 5 5 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 10 chrome108.0.0.0 4 4 chrome52.0.3624.98 8 8 chrome71.0.2623.112 2 2 chrome117.0.5938.132 16 4 chrome63.0.3239.132 3 2 chrome120.0.0.0 6 6 firefox95.0 1 1 Unknown 27 27 mozilla 17 10 chrome109.0.0.0 9 2 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 4 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20240131011831 Mozilla/5.0_(compatible;_CensysInspect/1.1;__https://about.censys.io/) 20240130100210 WordPress/6.4.3;_https://testsahyadrimahavidyalay.ptechinstitute.com 20240131214713 WordPress/6.4.2;_https://testsahyadrimahavidyalay.ptechinstitute.com 20240130100214 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 3 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20240131011831 WordPress/6.4.2;_https://testsahyadrimahavidyalay.ptechinstitute.com 20240130100214 WordPress/6.4.3;_https://testsahyadrimahavidyalay.ptechinstitute.com 20240131214713 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 66 69 From1 0 0 From2 0 0 From3 0 1 From4 0 23 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 1 http://216.10.248.207:80/favicon.ico 0 1 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 5 409 17 1411 404 59 1913921 301 81 0 406 5 1130 302 1 0 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 20 /debug/default/view 4 - /login.action 4 - /https:/testsahyadrimahavidyalay.ptechinstitute.com/wp-content/plugins/elementor/assets/lib/eicons/css/elementor-icons.min.css 2 http://216.10.248.207:80/'https://testsahyadrimahavidyalay.ptechinstitute.com/wp-content/plugins/elementor/assets/lib/eicons/css/elementor-icons.min.css /app-ads.txt 2 - /https:/testsahyadrimahavidyalay.ptechinstitute.com/wp-content/plugins/elementor/assets/lib/font-awesome/css/solid.min.css 2 http://216.10.248.207:80/'https://testsahyadrimahavidyalay.ptechinstitute.com/wp-content/plugins/elementor/assets/lib/font-awesome/css/solid.min.css /telescope/requests 4 - /.DS_Store 4 - /https:/testsahyadrimahavidyalay.ptechinstitute.com/wp-content/plugins/elementor/assets/lib/font-awesome/css/brands.min.css 1 http://216.10.248.207:80/'https://testsahyadrimahavidyalay.ptechinstitute.com/wp-content/plugins/elementor/assets/lib/font-awesome/css/brands.min.css /s/730323e2834323e20313e2631323/_/ 4 - /ads.txt 2 - /https:/testsahyadrimahavidyalay.ptechinstitute.com/wp-content/themes/bizberg/assets/icons/font-awesome-5/css/all.css 2 http://216.10.248.207:80/'https://testsahyadrimahavidyalay.ptechinstitute.com/wp-content/themes/bizberg/assets/icons/font-awesome-5/css/all.css /.git/config 6 - /config.json 2 - /v2/_catalog 4 - /https:/testsahyadrimahavidyalay.ptechinstitute.com/wp-content/plugins/elementor/assets/lib/font-awesome/css/regular.min.css 2 http://216.10.248.207:80/'https://testsahyadrimahavidyalay.ptechinstitute.com/wp-content/plugins/elementor/assets/lib/font-awesome/css/regular.min.css /ecp/Current/exporttool/microsoft.exchange.ediscovery.exporttool.application 4 - /.vscode/sftp.json 2 - / 2 http://www.testsahyadrimahavidyalay.ptechinstitute.com/// /_all_dbs 4 - /https:/testsahyadrimahavidyalay.ptechinstitute.com/wp-content/plugins/elementor/assets/lib/font-awesome/css/fontawesome.min.css 2 http://216.10.248.207:80/'https://testsahyadrimahavidyalay.ptechinstitute.com/wp-content/plugins/elementor/assets/lib/font-awesome/css/fontawesome.min.css END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 21 216.10.248.154 23 23 0 20240131214713 101.68.211.2 4 5 485785 20240103091250 184.107.184.25 4 4 1053652 20240130163317 139.144.150.8 2 2 390270 20240107073747 138.68.163.10 2 2 390270 20240105221918 65.154.226.168 2 8 2901997 20240105024855 46.101.103.192 2 2 390270 20240106083011 159.89.83.196 2 2 390270 20240107072313 65.154.226.170 2 8 2901997 20240105023247 49.38.158.129 2 9 2906112 20240111153443 167.248.133.182 2 5 395643 20240130100204 104.236.72.63 2 2 91396 20240102162248 167.248.133.124 2 3 95793 20240122043358 199.45.154.17 2 3 95631 20240113215941 199.45.155.17 2 3 95515 20240104151249 162.142.125.223 2 3 95515 20240101090838 198.235.24.44 2 2 529826 20240130191835 184.107.184.24 2 2 526826 20240130163315 205.210.31.69 2 2 529826 20240131011831 138.197.28.177 2 2 82864 20240130100329 101.53.147.36 1 1 280 20240129000625 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 19 20240101 3 4 95515 2 20240102 2 2 91396 1 20240103 6 7 485785 2 20240104 3 4 95515 2 20240105 8 20 6194264 4 20240106 3 3 390270 2 20240107 7 7 780540 3 20240111 3 10 2906112 2 20240112 1 1 0 1 20240113 3 4 95631 2 20240116 1 1 0 1 20240119 1 1 0 1 20240122 3 4 95793 2 20240124 1 1 0 1 20240126 1 1 0 1 20240128 1 1 0 1 20240129 2 2 280 2 20240130 13 16 2588811 6 20240131 4 4 529826 2 END_DAY # Session range - Number of visits BEGIN_SESSION 3 0s-30s 35 30s-2mn 1 5mn-15mn 2 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 3 / 42 5580162 19 19 /wp-cron.php 23 0 18 18 //wp-json/wp/v2/users/ 1 280 1 0 END_SIDER