AWSTATS DATA FILE 7.9 (build 20230108) # If you remove this file, all statistics for date 202501 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/awstats.testsahyadrimahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2075 POS_TIME 2734 POS_VISITOR 6167 POS_DAY 6315 POS_DOMAIN 3255 POS_LOGIN 3488 POS_ROBOT 3643 POS_WORMS 3806 POS_EMAILSENDER 3937 POS_EMAILRECEIVER 4080 POS_SESSION 6428 POS_FILESIZE 6689 POS_SIDER 6574 POS_FILETYPES 4215 POS_DOWNLOADS 4322 POS_OS 4370 POS_BROWSER 4466 POS_SCREENSIZE 4556 POS_UNKNOWNREFERER 4630 POS_UNKNOWNREFERERBROWSER 4717 POS_ORIGIN 4799 POS_SEREFERRALS 4929 POS_PAGEREFS 5073 POS_SEARCHWORDS 5221 POS_KEYWORDS 5373 POS_MISC 2398 POS_ERRORS 5432 POS_CLUSTER 3344 POS_SIDER_404 5561 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20250201174355 1 0 15646145399816 FirstTime 0 LastTime 20250127065059 LastUpdate 20250201183638 1 0 0 0 0 TotalVisits 2 TotalUnique 2 MonthHostsKnown 0 MonthHostsUnknown 2 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 JavaEnabled 0 0 0 WindowsMediaPlayerSupport 0 0 0 QuickTimeSupport 0 0 0 DirectorSupport 0 0 0 TotalMisc 0 0 0 PDFSupport 0 0 0 FlashSupport 0 0 0 AddToFavourites 0 0 0 JavascriptDisabled 0 0 0 RealPlayerSupport 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 0 0 0 0 0 0 1 0 0 0 4 4 0 2 0 0 0 4 4 75652 3 0 0 0 1 1 226 4 0 0 0 2 2 0 5 0 0 0 5 5 226 6 1 1 517 5 5 84832 7 0 0 0 0 0 0 8 0 0 0 4 4 0 9 0 0 0 10 12 246 10 0 0 0 5 7 410944 11 0 0 0 10 13 42494 12 0 0 0 2 2 83632 13 0 0 0 4 4 0 14 0 0 0 0 0 0 15 2 3 35623 6 8 118010 16 0 0 0 4 4 0 17 0 0 0 10 10 0 18 0 0 0 6 6 0 19 0 0 0 2 2 0 20 0 0 0 0 0 0 21 0 0 0 4 4 0 22 0 0 0 0 0 0 23 0 0 0 6 6 0 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 2 bg 2 2 0 us 1 2 36140 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 1 unknown 2 246 20250106094907 2 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 3 css 1 35623 0 0 php 1 517 0 0 html 2 0 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 0 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 2 macosx15 2 2 androidnougat 2 1 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 2 chrome60.0.3112.107 2 1 firefox77.0 2 2 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 0 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 0 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 2 2 From1 1 2 From2 0 0 From3 0 0 From4 0 0 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 5 302 1 0 406 7 1582 409 1 1200 301 80 0 404 12 813234 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 7 /wordpress/wp-admin/setup-config.php 1 www.google.com /wordpress/wp-admin/install.php 1 www.google.com /wp-admin.php 1 - /wordpress/wp-includes/css/dashicons.min.css 1 www.google.com /vendor/laravel-filemanager/js/script.js 1 - /.git/config 6 - /public/vendor/laravel-filemanager/js/script.js 1 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 2 87.120.126.158 2 2 0 20250120153719 165.22.252.197 1 2 36140 20250127065059 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 3 20250120 2 2 0 1 20250126 0 1 35623 0 20250127 1 1 517 1 END_DAY # Session range - Number of visits BEGIN_SESSION 1 0s-30s 2 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 2 /wp-content/ 2 0 1 1 //wp-admin/install.php 1 517 1 1 END_SIDER # Payload Range - Payload Frequency BEGIN_FILESIZE 5 500-1K 1 0-44 46 100-500 5 1K-2K 1 5K+ 11 END_FILESIZE