AWSTATS DATA FILE 7.8 (build 20200416) # If you remove this file, all statistics for date 202402 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/awstats.adhyapakmahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2037 POS_TIME 2709 POS_VISITOR 7183 POS_DAY 7827 POS_DOMAIN 3228 POS_LOGIN 3519 POS_ROBOT 3674 POS_WORMS 3875 POS_EMAILSENDER 4006 POS_EMAILRECEIVER 4149 POS_SESSION 8073 POS_SIDER 8240 POS_FILETYPES 4284 POS_DOWNLOADS 4429 POS_OS 4477 POS_BROWSER 4603 POS_SCREENSIZE 4781 POS_UNKNOWNREFERER 4855 POS_UNKNOWNREFERERBROWSER 5549 POS_ORIGIN 6034 POS_SEREFERRALS 6166 POS_PAGEREFS 6310 POS_SEARCHWORDS 6458 POS_KEYWORDS 6610 POS_MISC 2373 POS_ERRORS 6669 POS_CLUSTER 3375 POS_SIDER_404 6795 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20240301110855 1 0 29040331404063 FirstTime 20240215102748 LastTime 20240228212512 LastUpdate 20240301181428 1 0 0 0 0 TotalVisits 19 TotalUnique 14 MonthHostsKnown 0 MonthHostsUnknown 15 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 RealPlayerSupport 0 0 0 AddToFavourites 0 2 0 FlashSupport 0 0 0 QuickTimeSupport 0 0 0 TotalMisc 0 0 0 JavascriptDisabled 0 0 0 JavaEnabled 0 0 0 WindowsMediaPlayerSupport 0 0 0 PDFSupport 0 0 0 DirectorSupport 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 0 0 0 0 26 0 1 2 2 147052 0 0 0 2 0 0 0 0 0 0 3 0 0 0 0 0 0 4 0 0 0 0 0 0 5 0 0 0 0 0 0 6 0 0 0 0 0 0 7 7 7 117186 2 2 0 8 0 0 0 0 0 0 9 4 6 521647 0 0 0 10 9 11 71361 3 5 716 11 0 0 0 0 0 0 12 1 1 0 2 2 0 13 2 2 0 4 4 0 14 0 0 0 0 0 0 15 0 0 0 0 0 0 16 0 0 0 2 38 225570 17 1 1 0 2 2 0 18 0 0 0 0 0 0 19 2 2 39062 4 4 0 20 0 0 0 0 0 0 21 2 2 225570 0 0 0 22 0 0 0 0 0 0 23 2 2 0 3 3 23672 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 6 us 19 23 484931 ca 6 6 411684 fr 2 2 147052 gb 2 2 39062 be 2 2 39062 zz 1 1 87 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 2 Dalvik/ 4 0 20240215191800 0 no_user_agent 2 225570 20240225161132 0 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 5 html 19 777718 0 0 png 2 8238 0 0 Unknown 5 389 0 0 php 8 0 0 0 jpg 2 335533 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 0 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 5 Unknown 19 19 win8.1 2 0 linuxubuntu 2 2 win10 5 3 linux 8 8 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 7 chrome103.0.5060.66 1 1 chrome117.0.5938.132 4 2 mozilla 5 5 chrome108.0.0.0 8 8 Unknown 14 14 firefox115.0 2 2 firefox38.0 2 0 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 5 Mozilla/5.0_(compatible;_Let's_Encrypt_validation_server;__https://www.letsencrypt.org) 20240215102754 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20240228212512 Mozilla/5.0_(compatible;_InternetMeasurement/1.0;__https://internet-measurement.com/) 20240217073448 Cpanel-HTTP-Client/1.0 20240215102748 WordPress/6.4.3;_https://adhyapakmahavidyalay.ptechinstitute.com 20240224173839 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 3 Cpanel-HTTP-Client/1.0 20240215102748 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20240228212512 WordPress/6.4.3;_https://adhyapakmahavidyalay.ptechinstitute.com 20240224173839 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 32 34 From1 0 0 From2 0 0 From3 0 0 From4 0 2 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 5 101 1 0 301 72 0 404 2 22472 409 1 1200 403 2 716 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 2 /wordpress/wp-admin/setup-config.php 1 - /backup/wp-admin/setup-config.php 1 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 15 216.10.248.154 10 10 128 20240224173839 64.23.189.117 2 2 39062 20240221193537 188.165.87.106 2 2 147052 20240218093050 65.154.226.171 2 4 374595 20240216092145 159.89.53.85 2 2 39062 20240216075022 87.236.176.67 2 2 39062 20240217073448 192.34.56.139 2 2 54190 20240227102048 198.235.24.249 2 2 147052 20240220014044 205.210.31.207 2 2 225570 20240228212512 167.172.241.166 2 2 39062 20240218074047 18.191.119.204 1 1 87 20240215102754 54.184.222.16 1 1 87 20240215102754 23.178.112.108 1 1 87 20240215102754 184.73.118.105 1 1 8544 20240215103220 23.20.84.19 0 2 8238 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 9 20240215 9 11 17171 6 20240216 6 8 413657 3 20240217 2 2 39062 1 20240218 4 4 186114 2 20240220 2 2 147052 1 20240221 2 2 39062 1 20240224 3 3 0 3 20240227 2 2 54190 1 20240228 2 2 225570 1 END_DAY # Session range - Number of visits BEGIN_SESSION 3 0s-30s 17 2mn-5mn 1 30mn-1h 1 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 5 / 19 777718 10 10 /wp-cron.php 8 0 5 6 /.well-known/acme-challenge/NdbVJGJr24h2LdWMQYw99ZXNaDER75AfHQ3Y1yHaFxo 3 261 3 3 /.well-known/acme-challenge/F3MFPZMO64F7HUYZDLTOGL0BOFM0US9- 1 64 1 0 /.well-known/acme-challenge/S2T7MQFY1TAEIL-WF8Q_YHG5V9E81FJX 1 64 0 0 END_SIDER