AWSTATS DATA FILE 7.9 (build 20230108) # If you remove this file, all statistics for date 202502 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/awstats.adhyapakmahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2071 POS_TIME 2730 POS_VISITOR 10761 POS_DAY 11055 POS_DOMAIN 3251 POS_LOGIN 3486 POS_ROBOT 3641 POS_WORMS 3812 POS_EMAILSENDER 3943 POS_EMAILRECEIVER 4086 POS_SESSION 11133 POS_FILESIZE 11565 POS_SIDER 11279 POS_FILETYPES 4221 POS_DOWNLOADS 4305 POS_OS 4353 POS_BROWSER 4432 POS_SCREENSIZE 4508 POS_UNKNOWNREFERER 4582 POS_UNKNOWNREFERERBROWSER 4810 POS_ORIGIN 4930 POS_SEREFERRALS 5062 POS_PAGEREFS 5206 POS_SEARCHWORDS 5354 POS_KEYWORDS 5506 POS_MISC 2394 POS_ERRORS 5565 POS_CLUSTER 3342 POS_SIDER_404 5699 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20250301005211 1 0 13984912502040 FirstTime 0 LastTime 20250217033745 LastUpdate 20250301182839 1 0 0 0 0 TotalVisits 6 TotalUnique 6 MonthHostsKnown 0 MonthHostsUnknown 6 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 JavaEnabled 0 0 0 AddToFavourites 0 6 0 DirectorSupport 0 0 0 WindowsMediaPlayerSupport 0 0 0 FlashSupport 0 0 0 JavascriptDisabled 0 0 0 PDFSupport 0 0 0 TotalMisc 0 0 0 QuickTimeSupport 0 0 0 RealPlayerSupport 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 0 0 0 4 4 36962 1 0 0 0 2 4 36962 2 0 0 0 4 4 36962 3 14 14 1126 4 4 0 4 0 0 0 1 1 226 5 0 0 0 4 4 0 6 0 0 0 20 20 0 7 0 0 0 4 4 0 8 0 0 0 2 2 0 9 0 0 0 0 0 0 10 0 0 0 8 8 0 11 0 0 0 2 4 0 12 0 0 0 2 2 0 13 0 0 0 30 30 426785 14 0 0 0 0 2 0 15 0 0 0 4 6 0 16 0 0 0 402 429 7378712 17 0 0 0 6 6 0 18 0 0 0 6 8 36962 19 0 0 0 0 0 0 20 0 0 0 0 0 0 21 0 0 0 4 4 452 22 0 0 0 2 2 0 23 0 0 0 2 2 0 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 2 us 12 12 952 zz 2 2 174 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 1 no_user_agent 2 52560 20250226163530 0 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 1 Unknown 14 1126 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 0 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 1 Unknown 14 14 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 2 Unknown 4 4 mozilla 10 10 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 2 Cpanel-HTTP-Client/1.0 20250217033739 Mozilla/5.0_(compatible;_Let's_Encrypt_validation_server;__https://www.letsencrypt.org) 20250217033745 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 1 Cpanel-HTTP-Client/1.0 20250217033739 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 14 14 From1 0 0 From2 0 0 From3 0 0 From4 0 0 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 5 406 32 7232 403 2 716 409 1 1200 404 427 7892315 301 80 0 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 230 /info4.php 2 - /test 2 www.google.com /server/s3.js 1 - /config/cache.php 2 - /controller/admin/post.js 1 - /temp 2 www.google.com /developer.php 2 - /config/local.yml 2 - /.AWS_/credentials 2 - /rest.php 2 - /public/phpinfo.php 2 - /test123.php 2 - /infophp.php 2 - /phpcustom_info/phpinfo.php 2 - /dashboard/info.php 2 - /settings.py 2 - /env.template 2 - /test_phpinfo5.php 2 - /in.php 2 - /swagger.json 1 - /.env.test 2 - /phpsysinfo 2 - /phpsysinfo/phpinfo.php 2 - /phpinfo.php 2 - /configs/routes-4aug.js 1 - /_profiler/phpinfo/info.php 2 - /server-info.php 2 - /test_phpinfo3.php 2 - /.aws/config] 1 - /php.php 2 - /info3.php 2 - /index.html 2 - /apache.php 2 - /admin/sys_phpinfo.php 2 - /my_env/chakaash.py 2 - /phpinfo 2 - /index.js 1 - /index1.php 2 - /app.py 2 - /new.php 2 - /sms.py 2 - /.env.save 2 - /configs/routes.js 1 - /api/shared/config.env 2 - /api/shared/config/config.env 2 - /test6.php 2 - /my_env/palash.py 2 - /apache2.php 2 - /helper/EmailHelper.js 1 - /test.php 2 - /temp.php 2 - /debug/default/view 2 - /test_info5.php 2 - /test_phpinfo4.php 2 - /admin/controllers/merchant.js 1 - /backend/web/phpinfo.php 2 - /.env.settings 2 - /backend/config/settings.yml 2 - /.env.development 2 - /controller/api/post.js 1 - /phpinfo4.php 2 - /.env.production.local 2 - /admincontrol/sys_phpinfo.php 2 - /main.yml 2 - /inf.php 2 - /phpsysinfo/phpsysinfo.php 2 - /backend/config/development.yml 2 - /test_phpinfo1.php 2 - /config/settings.prod 2 - /phpinfo2.php 2 - /tz.php 2 - /up.php 2 - /apache/phpinfo.php 2 - /_profiler/phpinfo 2 - /config/aws.yml 2 - /test7.php 2 - /user/config/config.js 1 - /debug.php 2 - /api/config.js 1 - /test_info4.php 2 - /test_info2.php 2 - /test1.php 2 - /api/config.env 2 - /main.php 2 - /phpinfo.html 2 - /.env.live 2 - /tool/phpinfo.php 2 - /cloud/Scraper.js 1 - /.env.example.local 2 - /infos.php 2 - /lindex.php 2 - /aws.yml 2 - /config.env 2 - /apache/i.php 2 - /backend/phpinfo.php 2 - /.env.secure 2 - /dashboard/phpinfo.php 2 - /_profiler/phpinfo/phpinfo.php 2 - /test0.php 2 - /.git/config 2 - /.env.prod 2 - /admin/controllers/partner.js 1 - /.env_1 2 - /admin/config 2 - /server_info.php 2 - /test_phpinfo2.php 2 - /new 2 www.google.com /phpversion.php 2 - /.env.private 2 - /s3.js 1 - /apis/config/config.js 1 - /phpinfo/config.php 2 - /dashboard/i.php 2 - /time.php 2 - /.phpinfo 2 - /cache.php 2 - /old_phpinfo.php 2 - /getcpuutil.php-bakworking 2 - /.env.development.local 2 - /info2.php 2 - /.aws/config%5D 1 - /web.php%5D 1 - /phpinfo.php4 2 - /apache/info.php 2 - /blog 2 www.google.com /phpinfo3.php 2 - /deploy.php 2 - /appsettings.json 1 - /mytest/astech_robot.js 1 - /admin/phpinfo.php 2 - /gatsby-config.js 1 - /.env.production 2 - /backup 2 www.google.com /api/config/config.yml 2 - /php1.php 2 - /test2.php 2 - /server.js 1 - /controllers/settings.js 1 - /admin_phpinfo.php 2 - /adhyapakmahavidyalay 2 www.google.com /frontend_dev.php/$ 2 - /ppinfo.php 2 - /.env.dev.local 2 - /admin/.env 2 - /.env.prod.local 2 - /php52/phpinfo.php 2 - /partner/config/config.js 1 - /dev.php 2 - /helper.js 1 - /tester.php 2 - /phpinfo/info.php 2 - /php_info.php 2 - /karma.conf.json 1 - /admin/info.php 2 - /aws-secret.yaml 2 - /info1.php 2 - /user/controllers/index.js 1 - /test8.php 2 - /jo.php 2 - /test_info1.php 2 - /phpinfo1.php 2 - /isadmin.php 2 - /test_info3.php 2 - /test9.php 2 - /dashboard/test.php 2 - /phpinfoposmeta.php 2 - /api/objects/codes.php.save 2 - /linusadmin-phpinfo.php 2 - /backend/config/default.yml 2 - /phpinfodev.php 2 - /shared/config/config.js 1 - /wp 4 www.google.com /devs.php 2 - /of.php 2 - /test_phpinfo.php 2 - /.env.override 2 - /ads.txt 4 - /helpers/utility.js 1 - /.travis.yml 2 - /phpinfo/phpinfo.php 2 - /.env.dist 2 - /wordpress 4 www.google.com /.env.template 2 - /phpsysinfo/info.php 2 - /config/parameters.yml 2 - /apis/controllers/users.js 1 - /admin/server_info.php 2 - /.env.stage 2 - /aws/credentials 2 - /app.js 1 - /php-info.php 2 - /.aws/credentials 2 - /phpsysinfo.php 2 - /app/config/parameters.yml 2 - /pinfo.php 2 - /configs/s3_config.json 1 - /config/storage.yml 2 - /ini.php 2 - /.env.config 2 - /wordpress/wp-admin/setup-config.php 1 - /info.php 2 - /.circleci/configs/development.yml 2 - /test_info.php 2 - /web.php] 1 - /token.php 2 - /ocp.php 2 - /config/settings.local 2 - /phpinfos.php 2 - /dep.php 2 - /config.js 1 - /config/config.json 1 - /swagger.js 1 - /adminphp.php/configuration.php 2 - /test3.php 2 - /phptest.php 2 - /test5.php 2 - /.env_sample 2 - /adminphp.php 2 - /build.php 2 - /config/application.yml 4 - /config/settings.json 1 - /.vscode/sftp.json 1 - /test4.php 2 - /config.json 1 - /testing.php 2 - /sftp-config.json 1 - /.env.example 2 - /.env.local 2 - /symfony/_profiler/phpinfo 2 - /old 2 www.google.com END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 6 216.10.248.154 4 4 256 20250217033739 16.171.66.230 2 2 174 20250217033745 13.58.242.90 2 2 174 20250217033745 13.212.196.176 2 2 174 20250217033745 52.36.63.90 2 2 174 20250217033745 23.178.112.109 2 2 174 20250217033744 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 1 20250217 14 14 1126 6 END_DAY # Session range - Number of visits BEGIN_SESSION 1 0s-30s 6 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 3 /.well-known/acme-challenge/xZzxmJYby2pv6SWyD0AcWdddKix0UcoM0_6eSqCTI84 10 870 5 5 /.well-known/acme-challenge/PKBP9RS7Z_11TX9-42-7GEJ3EOSPB794 2 128 0 1 /.well-known/acme-challenge/TEISKMWFFCITQSOCRPLIZOL4KDV26_BI 2 128 1 0 END_SIDER # Payload Range - Payload Frequency BEGIN_FILESIZE 5 100-500 34 44-100 14 5K+ 429 0-44 86 1K-2K 1 END_FILESIZE