AWSTATS DATA FILE 7.8 (build 20200416) # If you remove this file, all statistics for date 202303 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/awstats.sahyadrimahavidyalaysawarde.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2044 POS_TIME 2718 POS_VISITOR 6103 POS_DAY 6450 POS_DOMAIN 3214 POS_LOGIN 3476 POS_ROBOT 3631 POS_WORMS 3763 POS_EMAILSENDER 3894 POS_EMAILRECEIVER 4037 POS_SESSION 6548 POS_SIDER 6694 POS_FILETYPES 4172 POS_DOWNLOADS 4287 POS_OS 4335 POS_BROWSER 4424 POS_SCREENSIZE 4541 POS_UNKNOWNREFERER 4615 POS_UNKNOWNREFERERBROWSER 4944 POS_ORIGIN 5064 POS_SEREFERRALS 5196 POS_PAGEREFS 5340 POS_SEARCHWORDS 5488 POS_KEYWORDS 5640 POS_MISC 2382 POS_ERRORS 5699 POS_CLUSTER 3332 POS_SIDER_404 5794 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20230401033223 4 799 14275431500004 FirstTime 20230330190434 LastTime 20230331232930 LastUpdate 20230401180410 4 0 3 0 0 TotalVisits 8 TotalUnique 6 MonthHostsKnown 0 MonthHostsUnknown 8 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 QuickTimeSupport 0 0 0 JavaEnabled 0 0 0 AddToFavourites 0 0 0 JavascriptDisabled 0 0 0 PDFSupport 0 0 0 FlashSupport 0 0 0 TotalMisc 0 0 0 WindowsMediaPlayerSupport 0 0 0 DirectorSupport 0 0 0 RealPlayerSupport 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 0 0 0 0 0 0 1 0 0 0 0 0 0 2 0 0 0 0 0 0 3 2 2 128 0 0 0 4 0 0 0 0 0 0 5 0 0 0 0 0 0 6 0 0 0 0 0 0 7 0 0 0 0 0 0 8 0 0 0 0 0 0 9 0 0 0 0 0 0 10 0 0 0 1 1 358 11 0 0 0 0 0 0 12 0 0 0 0 0 0 13 1 1 13978 0 0 0 14 0 0 0 0 0 0 15 0 0 0 0 0 0 16 0 0 0 0 0 0 17 0 0 0 0 0 0 18 0 0 0 0 0 0 19 8 8 650 5 7 1432 20 2 2 128 0 0 0 21 0 0 0 0 0 0 22 0 0 0 0 0 0 23 1 3 16207 0 0 0 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 4 us 10 12 2961 zz 2 2 174 gb 1 1 13978 be 1 1 13978 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 0 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 3 html 2 27956 0 0 Unknown 12 906 0 0 png 2 2229 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 0 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 2 Unknown 13 13 win10 3 1 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 4 mozilla 7 7 Unknown 6 6 chrome110.0.0.0 1 1 chrome95.0.4638.69 2 0 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 3 Mozilla/5.0_(compatible;_Let's_Encrypt_validation_server;__https://www.letsencrypt.org) 20230330190438 Cpanel-HTTP-Client/1.0 20230331033344 Mozilla/5.0_(compatible;_InternetMeasurement/1.0;__https://internet-measurement.com/) 20230331232930 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 1 Cpanel-HTTP-Client/1.0 20230331033344 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 14 16 From1 0 0 From2 0 0 From3 0 0 From4 0 0 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 2 403 5 1790 101 1 0 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 0 END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 8 216.10.248.154 6 6 384 20230331033344 3.138.184.165 2 2 174 20230330190437 23.178.112.203 2 2 174 20230330190438 35.86.168.8 2 2 174 20230330190438 87.236.176.67 1 1 13978 20230331232930 146.70.116.164 1 1 13978 20230331134236 165.22.39.64 0 1 1738 157.245.216.203 0 1 491 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 2 20230330 10 10 778 5 20230331 4 6 30313 3 END_DAY # Session range - Number of visits BEGIN_SESSION 1 0s-30s 8 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 9 /.well-known/acme-challenge/LQFPvZAmRN0QQ1u9c8XwAzbwgg3LBh1lmzbC2wgal64 3 261 3 0 /.well-known/acme-challenge/sLPKUKufSWJ2Vo696HDZSx9uor38k2KCRrofR6QnNXY 3 261 0 3 / 2 27956 2 2 /.well-known/acme-challenge/DUDGQ-E5VV9OS27LK6Y4JXM8OOYPDKTH 1 64 1 0 /.well-known/acme-challenge/70TIT7E-YFMIKSL6T7DDF6FXQZQ03VPO 1 64 0 1 /.well-known/acme-challenge/LK9_PVCC85UKCQ_A_QRTBXP3-2DXQ29F 1 64 0 1 /.well-known/acme-challenge/0BM3H506IXH_VNG03625XFE6J09DQ1O0 1 64 1 0 /.well-known/acme-challenge/SYTHQ53ZZQE4IM6C_J8I1NVPSEV0OV95 1 64 1 0 /.well-known/acme-challenge/_COZQ_J0LVAK64GV-559KSUCZLJRDQ3G 1 64 0 1 END_SIDER