AWSTATS DATA FILE 7.8 (build 20200416) # If you remove this file, all statistics for date 202403 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/awstats.adhyapakmahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2037 POS_TIME 2709 POS_VISITOR 7159 POS_DAY 7818 POS_DOMAIN 3260 POS_LOGIN 3544 POS_ROBOT 3699 POS_WORMS 3917 POS_EMAILSENDER 4048 POS_EMAILRECEIVER 4191 POS_SESSION 8124 POS_SIDER 8271 POS_FILETYPES 4326 POS_DOWNLOADS 4454 POS_OS 4502 POS_BROWSER 4626 POS_SCREENSIZE 4782 POS_UNKNOWNREFERER 4856 POS_UNKNOWNREFERERBROWSER 5495 POS_ORIGIN 5942 POS_SEREFERRALS 6074 POS_PAGEREFS 6218 POS_SEARCHWORDS 6366 POS_KEYWORDS 6518 POS_MISC 2373 POS_ERRORS 6577 POS_CLUSTER 3400 POS_SIDER_404 6694 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20240402025618 1 0 14044472153013 FirstTime 20240301110855 LastTime 20240330113739 LastUpdate 20240402182441 1 0 0 0 0 TotalVisits 17 TotalUnique 14 MonthHostsKnown 0 MonthHostsUnknown 15 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 AddToFavourites 0 2 0 FlashSupport 0 0 0 QuickTimeSupport 0 0 0 JavaEnabled 0 0 0 PDFSupport 0 0 0 TotalMisc 0 0 0 RealPlayerSupport 0 0 0 JavascriptDisabled 0 0 0 WindowsMediaPlayerSupport 0 0 0 DirectorSupport 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 0 0 0 0 0 0 1 0 0 0 2 2 225570 2 0 0 0 2 2 225644 3 0 0 0 0 0 0 4 1 1 0 2 2 0 5 3 3 225644 2 4 54408 6 0 0 0 0 0 0 7 0 0 0 0 0 0 8 2 2 225644 0 0 0 9 2 2 225644 0 0 0 10 2 2 53302 0 2 0 11 7 13 1012326 0 0 0 12 4 4 54150 5 9 282770 13 0 0 0 0 0 0 14 2 2 54150 0 0 0 15 2 2 53306 0 0 0 16 0 0 0 0 0 0 17 0 0 0 0 0 0 18 2 2 225644 0 0 0 19 0 0 0 0 0 0 20 2 2 53302 0 0 0 21 0 0 0 1 1 83 22 0 0 0 0 0 0 23 2 2 225644 1 1 226 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 5 us 15 15 269054 ca 12 12 1353790 nl 2 2 53306 be 2 2 53302 in 0 6 679304 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 2 no_user_agent 6 676858 20240311125104 0 bot[\s_+:,\.\;\/\\-] 4 54408 20240317055312 2 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 4 jpg 4 671066 0 0 png 2 8238 0 0 php 5 0 0 0 html 26 1729452 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 0 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 5 linux 2 2 win10 6 0 macosx15 6 6 macosx6 2 2 Unknown 21 21 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 6 Unknown 17 17 chrome123.0.0.0 6 0 mozilla 4 4 chrome121.0.0.0 6 6 chrome104.0.0.0 2 2 chrome108.0.0.0 2 2 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 4 WordPress/6.4.3;_https://adhyapakmahavidyalay.ptechinstitute.com 20240323110146 Mozilla/5.0_(compatible;_CensysInspect/1.1;__https://about.censys.io/) 20240325100346 Mozilla/5.0_(compatible;_InternetMeasurement/1.0;__https://internet-measurement.com/) 20240330113739 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20240316235334 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 2 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20240316235334 WordPress/6.4.3;_https://adhyapakmahavidyalay.ptechinstitute.com 20240323110146 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 31 31 From1 0 0 From2 0 0 From3 0 0 From4 0 6 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 4 409 2 1283 404 3 55926 301 5 0 406 1 226 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 3 /wp-content/plugins/royal-elementor-addons/assets/css/frontend.min.css 1 - /wp-content/themes/bricks/style.css 1 - /wordpress/wp-admin/setup-config.php 1 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 15 216.10.248.154 5 5 0 20240323110146 199.45.155.51 2 2 53302 20240325100346 198.235.24.84 2 2 225644 20240316183900 198.235.24.237 2 2 225644 20240312051900 205.210.31.76 2 2 225570 20240301110855 205.210.31.254 2 2 225644 20240312094006 174.129.178.163 2 2 54150 20240316113643 147.182.177.88 2 2 53302 20240326202740 104.131.12.155 2 2 54150 20240306144955 198.235.24.220 2 2 225644 20240308083834 146.190.233.35 2 2 54150 20240312125213 205.210.31.29 2 2 225644 20240316235334 188.166.37.52 2 2 53306 20240320154302 87.236.176.155 2 2 53302 20240330113739 115.110.127.198 0 6 679304 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 12 20240301 2 2 225570 1 20240306 3 3 54150 2 20240308 2 2 225644 1 20240312 6 6 505438 3 20240316 6 6 505438 3 20240317 1 1 0 1 20240319 2 2 0 1 20240320 2 2 53306 1 20240323 1 7 679304 1 20240325 2 2 53302 1 20240326 2 2 53302 1 20240330 2 2 53302 1 END_DAY # Session range - Number of visits BEGIN_SESSION 1 0s-30s 17 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 2 / 26 1729452 13 13 /wp-cron.php 5 0 4 4 END_SIDER