AWSTATS DATA FILE 7.8 (build 20200416) # If you remove this file, all statistics for date 202403 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/awstats.testsahyadrimahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2041 POS_TIME 2700 POS_VISITOR 6736 POS_DAY 7151 POS_DOMAIN 3260 POS_LOGIN 3518 POS_ROBOT 3673 POS_WORMS 3935 POS_EMAILSENDER 4066 POS_EMAILRECEIVER 4209 POS_SESSION 7320 POS_SIDER 7466 POS_FILETYPES 4344 POS_DOWNLOADS 4476 POS_OS 4524 POS_BROWSER 4654 POS_SCREENSIZE 4816 POS_UNKNOWNREFERER 4890 POS_UNKNOWNREFERERBROWSER 5147 POS_ORIGIN 5313 POS_SEREFERRALS 5446 POS_PAGEREFS 5590 POS_SEARCHWORDS 5738 POS_KEYWORDS 5890 POS_MISC 2364 POS_ERRORS 5949 POS_CLUSTER 3374 POS_SIDER_404 6071 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20240401221912 1 0 13543253659322 FirstTime 0 LastTime 20240314121238 LastUpdate 20240402182429 1 0 0 0 0 TotalVisits 8 TotalUnique 8 MonthHostsKnown 0 MonthHostsUnknown 9 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 WindowsMediaPlayerSupport 0 0 0 RealPlayerSupport 0 0 0 TotalMisc 0 0 0 DirectorSupport 0 0 0 JavaEnabled 0 0 0 PDFSupport 0 0 0 QuickTimeSupport 0 0 0 AddToFavourites 0 4 0 JavascriptDisabled 0 0 0 FlashSupport 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 0 0 0 0 0 0 1 0 0 0 7 7 415 2 1 1 669 2 2 166 3 0 0 0 0 0 0 4 0 0 0 1 1 83 5 2 4 290125 4 6 535114 6 0 0 0 1 1 83 7 0 0 0 1 1 83 8 2 4 290125 0 2 0 9 0 0 0 0 0 0 10 0 0 0 3 5 329 11 0 0 0 5 5 83 12 5 11 3403005 31 31 1465324 13 2 2 535114 31 31 1465912 14 0 0 0 2 2 0 15 0 0 0 3 3 83 16 0 0 0 7 7 83 17 0 6 2810601 3 3 83 18 0 0 0 5 5 83 19 0 0 0 14 14 245308 20 0 0 0 2 2 166 21 0 0 0 3 3 83 22 0 0 0 1 1 83 23 2 2 113116 8 8 641 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 3 us 10 14 1173223 in 2 14 5734418 ca 2 2 535114 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 3 Go\-http\-client/ 10 165456 20240308130137 0 no_user_agent 6 1605342 20240310055023 0 bot[\s_+:,\.\;\/\\-] 2 246 20240315101246 2 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 4 html 13 1467535 0 0 php 1 0 0 0 png 4 354018 0 0 jpg 12 5621202 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 0 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 5 Unknown 9 5 linux 2 2 androidmarshmallow 4 4 win10 14 2 win7 1 1 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 6 chrome72.0.3626.121 1 1 chrome122.0.0.0 14 2 Unknown 1 1 chrome108.0.0.0 2 2 mozilla 8 4 chrome52.0.3624.98 4 4 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 2 WordPress/6.4.3;_https://testsahyadrimahavidyalay.ptechinstitute.com 20240314121238 Mozilla/5.0_(compatible;_CensysInspect/1.1;__https://about.censys.io/) 20240310084850 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 1 WordPress/6.4.3;_https://testsahyadrimahavidyalay.ptechinstitute.com 20240314121238 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 14 18 From1 0 0 From2 0 0 From3 0 0 From4 0 12 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 4 404 50 1940242 409 27 2241 406 3 678 301 38 0 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 15 /axis2/axis2-admin/ 2 - /axis2-admin/ 2 - /.vscode/sftp.json 2 - /telescope/requests 4 - /server 4 - /axis2/ 2 - /_all_dbs 4 - /.DS_Store 4 - /s/730323e2834323e20313e2631323/_/ 4 - /config.json 2 - /debug/default/view 4 - /v2/_catalog 4 - /ecp/Current/exporttool/microsoft.exchange.ediscovery.exporttool.application 4 - /login.action 4 - /.git/config 4 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 9 159.89.12.166 2 2 535114 20240308130108 167.94.138.34 2 4 290125 20240306050138 199.45.154.50 2 4 290125 20240310084847 209.97.180.8 2 2 479188 20240308122535 111.93.159.50 2 8 2923817 20240314120617 165.232.101.54 2 2 113116 20240308232424 162.19.170.225 1 1 669 20240310020034 216.10.248.154 1 1 0 20240314121238 115.96.217.112 0 6 2810601 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 5 20240305 0 6 2810601 0 20240306 2 4 290125 1 20240308 6 6 1127418 3 20240310 3 5 290794 2 20240314 3 9 2923817 2 END_DAY # Session range - Number of visits BEGIN_SESSION 1 0s-30s 8 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 3 / 12 1466866 6 6 /wp-cron.php 1 0 1 1 /wp-json/ 1 669 1 1 END_SIDER