AWSTATS DATA FILE 7.9 (build 20230108) # If you remove this file, all statistics for date 202503 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/awstats.adhyapakmahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2071 POS_TIME 2719 POS_VISITOR 6080 POS_DAY 6179 POS_DOMAIN 3227 POS_LOGIN 3451 POS_ROBOT 3606 POS_WORMS 3738 POS_EMAILSENDER 3869 POS_EMAILRECEIVER 4012 POS_SESSION 6256 POS_FILESIZE 6454 POS_SIDER 6393 POS_FILETYPES 4147 POS_DOWNLOADS 4227 POS_OS 4275 POS_BROWSER 4358 POS_SCREENSIZE 4432 POS_UNKNOWNREFERER 4506 POS_UNKNOWNREFERERBROWSER 4593 POS_ORIGIN 4675 POS_SEREFERRALS 4805 POS_PAGEREFS 4949 POS_SEARCHWORDS 5097 POS_KEYWORDS 5249 POS_MISC 2383 POS_ERRORS 5308 POS_CLUSTER 3307 POS_SIDER_404 5428 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20250401133651 3 680 14885591271508 FirstTime 0 LastTime 0 LastUpdate 20250401184144 3 0 2 0 0 TotalVisits 0 TotalUnique 0 MonthHostsKnown 0 MonthHostsUnknown 1 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 JavaEnabled 0 0 0 QuickTimeSupport 0 0 0 RealPlayerSupport 0 0 0 JavascriptDisabled 0 0 0 WindowsMediaPlayerSupport 0 0 0 FlashSupport 0 0 0 DirectorSupport 0 0 0 PDFSupport 0 0 0 AddToFavourites 0 6 0 TotalMisc 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 0 0 0 5 5 226 1 0 0 0 4 4 0 2 0 0 0 0 0 0 3 0 0 0 0 0 0 4 0 0 0 0 0 0 5 0 0 0 0 0 0 6 0 0 0 0 0 0 7 0 0 0 2 4 36962 8 0 0 0 4 6 0 9 0 0 0 2 2 0 10 0 0 0 34 36 444066 11 0 0 0 6 6 0 12 0 0 0 6 8 0 13 0 0 0 2 2 0 14 0 0 0 3 3 19907 15 0 0 0 4 4 0 16 0 0 0 2 2 0 17 0 0 0 2 2 0 18 0 1 35623 4 5 0 19 0 0 0 14 14 0 20 0 0 0 2 2 0 21 0 0 0 2 2 0 22 0 0 0 8 8 36962 23 0 0 0 2 2 36962 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 1 gr 0 1 35623 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 0 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 1 css 1 35623 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 0 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 1 androidnougat 1 0 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 1 chrome60.0.3112.107 1 0 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 0 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 0 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 0 0 From1 0 1 From2 0 0 From3 0 0 From4 0 0 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 4 406 2 452 404 31 573433 409 1 1200 301 77 0 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 14 /wordpress 4 www.google.com /temp 2 www.google.com /blog 2 www.google.com /.vscode/sftp.json 1 - /sftp-config.json 1 - /wp 4 www.google.com /old 2 www.google.com /.git/config 4 - /adhyapakmahavidyalay 2 www.google.com /new 2 www.google.com /wordpress/wp-admin/setup-config.php 1 - /test 2 www.google.com /backup 2 www.google.com /ads.txt 2 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 1 178.128.104.103 0 1 35623 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 1 20250331 0 1 35623 0 END_DAY # Session range - Number of visits BEGIN_SESSION 0 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 0 END_SIDER # Payload Range - Payload Frequency BEGIN_FILESIZE 4 100-500 2 1K-2K 1 5K+ 32 0-44 83 END_FILESIZE