AWSTATS DATA FILE 7.8 (build 20200416) # If you remove this file, all statistics for date 202404 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/awstats.adhyapakmahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2037 POS_TIME 2697 POS_VISITOR 6298 POS_DAY 6592 POS_DOMAIN 3207 POS_LOGIN 3442 POS_ROBOT 3597 POS_WORMS 3815 POS_EMAILSENDER 3946 POS_EMAILRECEIVER 4089 POS_SESSION 6670 POS_SIDER 6816 POS_FILETYPES 4224 POS_DOWNLOADS 4308 POS_OS 4356 POS_BROWSER 4435 POS_SCREENSIZE 4511 POS_UNKNOWNREFERER 4585 POS_UNKNOWNREFERERBROWSER 4813 POS_ORIGIN 4933 POS_SEREFERRALS 5065 POS_PAGEREFS 5209 POS_SEARCHWORDS 5357 POS_KEYWORDS 5509 POS_MISC 2361 POS_ERRORS 5568 POS_CLUSTER 3298 POS_SIDER_404 5687 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20240501051756 3 812 8097835640293 FirstTime 0 LastTime 20240417034050 LastUpdate 20240501182857 3 0 2 0 0 TotalVisits 6 TotalUnique 6 MonthHostsKnown 0 MonthHostsUnknown 6 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 TotalMisc 0 0 0 AddToFavourites 0 2 0 DirectorSupport 0 0 0 QuickTimeSupport 0 0 0 JavascriptDisabled 0 0 0 FlashSupport 0 0 0 RealPlayerSupport 0 0 0 WindowsMediaPlayerSupport 0 0 0 PDFSupport 0 0 0 JavaEnabled 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 0 0 0 2 2 166 1 0 0 0 0 0 0 2 0 0 0 3 3 226 3 14 14 1126 35 35 393563 4 0 0 0 14 16 0 5 0 0 0 2 2 0 6 0 0 0 36 36 408278 7 0 0 0 0 0 0 8 0 0 0 8 12 440 9 0 0 0 1 1 83 10 0 0 0 0 0 0 11 0 0 0 2 2 0 12 0 0 0 6 6 0 13 0 0 0 0 0 0 14 0 0 0 0 0 0 15 0 0 0 0 0 0 16 0 0 0 2 2 36940 17 0 0 0 2 2 0 18 0 0 0 4 4 0 19 0 0 0 2 2 0 20 0 0 0 4 4 0 21 0 0 0 4 4 0 22 0 0 0 0 0 0 23 0 0 0 0 0 0 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 2 us 12 12 952 zz 2 2 174 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 2 Go\-http\-client/ 8 2492 20240429064838 0 bot[\s_+:,\.\;\/\\-] 4 440 20240415084707 4 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 1 Unknown 14 1126 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 0 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 1 Unknown 14 14 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 2 mozilla 10 10 Unknown 4 4 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 2 Cpanel-HTTP-Client/1.0 20240417034043 Mozilla/5.0_(compatible;_Let's_Encrypt_validation_server;__https://www.letsencrypt.org) 20240417034050 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 1 Cpanel-HTTP-Client/1.0 20240417034043 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 14 14 From1 0 0 From2 0 0 From3 0 0 From4 0 0 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 4 404 46 835611 409 3 249 406 4 904 301 66 0 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 12 /server 4 - /login.action 4 - /.vscode/sftp.json 2 - /s/730323e2834323e20313e2631323/_/ 4 - /.DS_Store 4 - /telescope/requests 4 - /v2/_catalog 4 - /_all_dbs 4 - /ecp/Current/exporttool/microsoft.exchange.ediscovery.exporttool.application 4 - /.git/config 6 - /debug/default/view 4 - /config.json 2 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 6 216.10.248.154 4 4 256 20240417034043 23.178.112.203 2 2 174 20240417034050 54.255.52.195 2 2 174 20240417034050 52.26.187.41 2 2 174 20240417034050 18.220.119.203 2 2 174 20240417034050 16.16.216.3 2 2 174 20240417034050 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 1 20240417 14 14 1126 6 END_DAY # Session range - Number of visits BEGIN_SESSION 1 0s-30s 6 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 3 /.well-known/acme-challenge/vs0hiXPs3LgGGbdgmZoFuQGsb-HjkzGnbNsNKNfpAdM 10 870 5 5 /.well-known/acme-challenge/VMR__O7R_8OUETW27BWS16M2B8J52ZFQ 2 128 1 0 /.well-known/acme-challenge/2B57S9YL4QNZ4_HY8KUGSFGRHR6I2AGX 2 128 0 1 END_SIDER