AWSTATS DATA FILE 7.8 (build 20200416) # If you remove this file, all statistics for date 202404 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/awstats.testsahyadrimahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2041 POS_TIME 2701 POS_VISITOR 6489 POS_DAY 6783 POS_DOMAIN 3234 POS_LOGIN 3469 POS_ROBOT 3624 POS_WORMS 3874 POS_EMAILSENDER 4005 POS_EMAILRECEIVER 4148 POS_SESSION 6861 POS_SIDER 7007 POS_FILETYPES 4283 POS_DOWNLOADS 4367 POS_OS 4415 POS_BROWSER 4494 POS_SCREENSIZE 4570 POS_UNKNOWNREFERER 4644 POS_UNKNOWNREFERERBROWSER 4872 POS_ORIGIN 4992 POS_SEREFERRALS 5124 POS_PAGEREFS 5268 POS_SEARCHWORDS 5416 POS_KEYWORDS 5568 POS_MISC 2365 POS_ERRORS 5627 POS_CLUSTER 3325 POS_SIDER_404 5752 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20240501064825 4 506 7338717308275 FirstTime 0 LastTime 20240408033501 LastUpdate 20240501182842 4 0 3 0 0 TotalVisits 6 TotalUnique 6 MonthHostsKnown 0 MonthHostsUnknown 6 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 JavaEnabled 0 0 0 JavascriptDisabled 0 0 0 DirectorSupport 0 0 0 AddToFavourites 0 2 0 TotalMisc 0 0 0 WindowsMediaPlayerSupport 0 0 0 RealPlayerSupport 0 0 0 PDFSupport 0 0 0 QuickTimeSupport 0 0 0 FlashSupport 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 0 0 0 2 2 0 1 0 0 0 2 2 0 2 0 0 0 4 4 0 3 14 14 1126 83 83 1807509 4 0 0 0 69 69 1761733 5 0 0 0 1 1 226 6 0 0 0 33 33 905922 7 0 0 0 4 4 0 8 0 0 0 0 0 0 9 0 0 0 0 0 0 10 0 0 0 10 14 246 11 0 0 0 4 5 83000 12 0 0 0 7 7 83 13 0 0 0 0 0 0 14 0 0 0 2 2 0 15 0 0 0 2 2 81656 16 0 0 0 5 5 83 17 0 0 0 9 11 329 18 0 0 0 6 6 0 19 0 0 0 8 10 246 20 0 0 0 3 3 83 21 0 0 0 5 5 83 22 0 0 0 3 3 249 23 0 0 0 2 2 166 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 2 us 12 12 952 zz 2 2 174 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 3 Go\-http\-client/ 20 6520 20240429062500 0 bot[\s_+:,\.\;\/\\-] 4 492 20240414173547 4 unknown 2 246 20240412103544 2 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 1 Unknown 14 1126 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 0 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 1 Unknown 14 14 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 2 mozilla 10 10 Unknown 4 4 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 2 Mozilla/5.0_(compatible;_Let's_Encrypt_validation_server;__https://www.letsencrypt.org) 20240408033501 Cpanel-HTTP-Client/1.0 20240408033454 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 1 Cpanel-HTTP-Client/1.0 20240408033454 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 14 14 From1 0 0 From2 0 0 From3 0 0 From4 0 0 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 4 409 15 2362 404 114 4630638 406 6 1356 301 110 0 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 14 /ecp/Current/exporttool/microsoft.exchange.ediscovery.exporttool.application 10 - /debug/default/view 10 - /.vscode/sftp.json 5 - /server 10 - /s/730323e2834323e20313e2631323/_/ 10 - /telescope/requests 10 - /.git/config 12 - /login.action 10 - /v2/_catalog 10 - /wordpress/wp-admin/setup-config.php 1 - /config.json 5 - /_all_dbs 10 - /wp-content/plugins/royal-elementor-addons/assets/css/frontend.min.css 1 - /.DS_Store 10 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 6 216.10.248.154 4 4 256 20240408033455 23.178.112.201 2 2 174 20240408033501 34.208.71.86 2 2 174 20240408033501 13.214.190.246 2 2 174 20240408033500 13.58.190.32 2 2 174 20240408033500 13.51.174.72 2 2 174 20240408033500 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 1 20240408 14 14 1126 6 END_DAY # Session range - Number of visits BEGIN_SESSION 1 0s-30s 6 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 3 /.well-known/acme-challenge/_j1DwBKT8Mi1t2ZD-THIPYxSqqAhTATnAw_kUGaPpLk 10 870 5 5 /.well-known/acme-challenge/1PO1ODGTMEDYCSKTFE7O2UDZK6B4GFXE 2 128 0 1 /.well-known/acme-challenge/UM2YQOTUOHPK96SC6G2XCUXQD_MH7ZBF 2 128 1 0 END_SIDER