AWSTATS DATA FILE 7.9 (build 20230108) # If you remove this file, all statistics for date 202504 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/awstats.adhyapakmahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2071 POS_TIME 2730 POS_VISITOR 8316 POS_DAY 8683 POS_DOMAIN 3274 POS_LOGIN 3522 POS_ROBOT 3677 POS_WORMS 3809 POS_EMAILSENDER 3940 POS_EMAILRECEIVER 4083 POS_SESSION 8820 POS_FILESIZE 9338 POS_SIDER 8966 POS_FILETYPES 4218 POS_DOWNLOADS 4347 POS_OS 4395 POS_BROWSER 4502 POS_SCREENSIZE 4626 POS_UNKNOWNREFERER 4700 POS_UNKNOWNREFERERBROWSER 4928 POS_ORIGIN 5048 POS_SEREFERRALS 5180 POS_PAGEREFS 5324 POS_SEARCHWORDS 5472 POS_KEYWORDS 5624 POS_MISC 2394 POS_ERRORS 5683 POS_CLUSTER 3378 POS_SIDER_404 5820 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20250501043221 1 0 13581563560585 FirstTime 0 LastTime 20250428061943 LastUpdate 20250501184924 1 0 0 0 0 TotalVisits 8 TotalUnique 8 MonthHostsKnown 0 MonthHostsUnknown 8 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 JavascriptDisabled 0 0 0 JavaEnabled 0 0 0 RealPlayerSupport 0 0 0 WindowsMediaPlayerSupport 0 0 0 FlashSupport 0 0 0 DirectorSupport 0 0 0 PDFSupport 0 0 0 AddToFavourites 0 2 0 TotalMisc 0 0 0 QuickTimeSupport 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 0 0 0 1 1 226 1 0 0 0 62 62 1035388 2 0 0 0 2 2 0 3 14 14 1126 10 10 0 4 0 0 0 4 6 0 5 0 0 0 4 4 0 6 2 2 716 142 155 2131985 7 0 0 0 16 16 0 8 0 0 0 21 21 226 9 0 0 0 6 6 0 10 1 1 505 11 11 38162 11 0 0 0 6 6 0 12 0 0 0 6 6 0 13 0 0 0 10 10 0 14 0 0 0 12 12 0 15 0 0 0 6 6 73924 16 0 1 35623 2 4 18481 17 0 0 0 7 7 37188 18 0 0 0 0 0 0 19 0 0 0 0 0 0 20 0 0 0 2 2 0 21 0 0 0 6 6 36962 22 0 0 0 4 4 0 23 0 0 0 4 4 0 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 3 us 13 14 37080 zz 2 2 174 sc 2 2 716 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 0 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 4 css 1 35623 0 0 Unknown 15 1484 0 0 php 1 505 0 0 html 1 358 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 0 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 3 Unknown 14 14 androidnougat 2 1 win10 2 2 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 4 mozilla 10 10 chrome60.0.3112.107 2 1 Unknown 4 4 chrome91.0.4472.124 2 2 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 2 Cpanel-HTTP-Client/1.0 20250419033846 Mozilla/5.0_(compatible;_Let's_Encrypt_validation_server;__https://www.letsencrypt.org) 20250419033852 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 1 Cpanel-HTTP-Client/1.0 20250419033846 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 16 16 From1 1 2 From2 0 0 From3 0 0 From4 0 0 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 5 301 135 0 409 19 2694 403 4 1432 406 19 4294 404 182 3364122 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 100 /sftp-config.json 1 - /staging.env 2 - /media../.git/config 2 - /.git/config 8 - /config/packages/ 2 - /.git/objects/ 2 - /yarn.lock 2 - /swagger-ui.html 2 - /app.js 1 - /stage.env 2 - /s3cmd.ini 2 - /app/.git/config 2 - /plugins/.git/config 2 - /admin/.git/config 2 - /secrets.json 1 - /database.json 1 - /laravel/.git/config 2 - /src/.git/config 2 - /backup.env 2 - /.dockerignore 2 - /var/logs/prod.log 1 - /secure-config.json 1 - /storage/logs/laravel.log 1 - /sandbox/.git/config 2 - /config.js 1 - /scripts/.git/config 2 - /storage/framework/views/ 2 - /.vscode/sftp.json 1 - /auth.json 1 - /config/default.json 1 - /config/secrets.json 1 - /composer.json 1 - /.gitignore 2 - /.aws/credentials 2 - /.git/logs/ 2 - /db.ini 2 - /.git/index 2 - /api-docs 2 - /config/production.json 1 - /public/.git/config 2 - /logs/.git/config 2 - /.git/packed-refs 2 - /prod.env 2 - /wp-content/.git/config 2 - /core/.git/config 2 - /dev/.git/config 2 - /sites/all/modules/ 2 - /.git/branches/ 2 - /local_settings.py 2 - /.env.test 2 - /config/database.yml 2 - /wordpress/wp-admin/setup-config.php 1 www.google.com /panel/.git/config 2 - /.env.local 2 - /development.env 2 - /var/log/exception.log 1 - /backend/.git/config 2 - /api/credentials 2 - /app/etc/local.xml 2 - /package.json 1 - /sites/all/themes/ 2 - /settings.yaml 2 - /storage/framework/sessions/ 2 - /.well-known/security.txt 2 - /credentials.env 2 - /.svn/entries 2 - /docs/.git/config 2 - /helm/values.yaml 2 - /old/.git/config 2 - /wordpress/wp-includes/css/dashicons.min.css 1 www.google.com /www/.git/config 2 - /.env.dev 2 - /.npmrc 2 - /template/.git/config 2 - /.git/refs/ 2 - /wordpress/wp-admin/install.php 1 www.google.com /dist/.git/config 2 - /api/.git/config 2 - /api/config.json 1 - /files/.git/config 2 - /var/logs/dev.log 1 - /source/.git/config 2 - /assets/.git/config 2 - /Dockerfile 2 - /env.txt 2 - /nova-api/styles 2 - /test/.git/config 2 - /.git/HEAD 4 - /frontend/.git/config 2 - /storage/framework/cache/ 2 - /openapi.json 1 - /.git/logs/HEAD 2 - /.env.example 2 - /src/config.js 1 - /.env.production 2 - /swagger.json 1 - /lib/.git/config 2 - /js../.git/config 2 - /wp-content/debug.log 1 - /server.js 1 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 8 216.10.248.154 4 4 256 20250419033846 3.1.196.13 2 2 174 20250419033852 154.83.103.210 2 2 716 20250428061943 16.171.57.205 2 2 174 20250419033852 23.178.112.215 2 2 174 20250419033851 3.133.122.171 2 2 174 20250419033852 54.202.80.3 2 2 174 20250419033852 165.22.98.20 1 2 36128 20250406101819 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 4 20250403 0 1 35623 0 20250406 1 1 505 1 20250419 14 14 1126 6 20250428 2 2 716 1 END_DAY # Session range - Number of visits BEGIN_SESSION 1 0s-30s 8 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 6 /.well-known/acme-challenge/ad1GycyuAohp1CdJcXd7rdIPZR7W4_aK_giMXhcsz9Y 10 870 5 5 /.well-known/acme-challenge/UW8TR9L0_DSI33J-R2CHDEA3X1UFGNVZ 2 128 0 1 /.well-known/acme-challenge/VJMX7R744K74O5WHLHXCJEJ689954A1Z 2 128 1 0 /server-status 1 358 0 1 //wp-admin/install.php 1 505 1 1 /cgi-sys/403.html 1 358 1 0 END_SIDER # Payload Range - Payload Frequency BEGIN_FILESIZE 6 5K+ 183 1K-2K 1 44-100 32 100-500 25 500-1K 1 0-44 137 END_FILESIZE