AWSTATS DATA FILE 7.9 (build 20230108) # If you remove this file, all statistics for date 202504 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/awstats.sahyadrimahavidyalaysawarde.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2078 POS_TIME 2750 POS_VISITOR 8597 POS_DAY 10994 POS_DOMAIN 3391 POS_LOGIN 3746 POS_ROBOT 3901 POS_WORMS 4073 POS_EMAILSENDER 4204 POS_EMAILRECEIVER 4347 POS_SESSION 11728 POS_FILESIZE 17136 POS_SIDER 11885 POS_FILETYPES 4482 POS_DOWNLOADS 4685 POS_OS 4733 POS_BROWSER 4940 POS_SCREENSIZE 5338 POS_UNKNOWNREFERER 5412 POS_UNKNOWNREFERERBROWSER 6049 POS_ORIGIN 6454 POS_SEREFERRALS 6591 POS_PAGEREFS 6754 POS_SEARCHWORDS 6902 POS_KEYWORDS 7054 POS_MISC 2414 POS_ERRORS 7113 POS_CLUSTER 3602 POS_SIDER_404 7226 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20250501033913 1 0 14035069886488 FirstTime 20250401034300 LastTime 20250430033921 LastUpdate 20250501184913 1 0 0 0 0 TotalVisits 87 TotalUnique 54 MonthHostsKnown 0 MonthHostsUnknown 60 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 DirectorSupport 0 0 0 RealPlayerSupport 0 0 0 FlashSupport 0 0 0 JavaEnabled 0 0 0 JavascriptDisabled 0 0 0 PDFSupport 0 0 0 QuickTimeSupport 0 0 0 AddToFavourites 0 0 0 WindowsMediaPlayerSupport 0 0 0 TotalMisc 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 11 52 26151820 2 2 452 1 15 62 26320787 18 18 107622 2 34 198 104467500 0 0 0 3 135 178 26217641 0 2 0 4 4 4 196588 0 0 0 5 8 10 254729 12 14 2569 6 0 0 0 0 0 0 7 0 0 0 40 40 120448 8 2 4 30185 0 0 0 9 4 6 58141 22 26 7876 10 13 22 297489 2 4 452 11 13 59 26184725 0 10 716 12 2 3 28447 15 17 3611 13 0 0 0 0 0 0 14 29 70 26966128 0 4 0 15 4 4 256 0 0 0 16 8 8 512 18 18 107622 17 2 3 28447 0 2 716 18 6 7 28703 0 2 716 19 0 0 0 2 2 452 20 0 0 0 0 0 0 21 13 61 26293322 60 60 21216 22 0 0 0 0 0 0 23 0 0 0 0 0 0 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 10 us 265 692 261808315 ca 18 18 884646 cn 6 19 310469 in 4 4 196588 nl 2 2 27956 au 2 2 98294 ua 2 8 141011 it 2 2 27956 ru 2 3 29694 be 0 1 491 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 1 no_user_agent 6 294882 20250425013830 0 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 7 woff2 50 5379960 0 0 js 78 1469715 0 0 png 20 18549 0 0 jpg 260 252838780 0 0 html 117 2479482 0 0 Unknown 136 8704 0 0 css 90 1330230 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 0 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 9 Unknown 184 166 macosx 2 2 androidnougat 2 2 androidoreo 150 27 ios_iphone 100 18 win10 188 59 macos11 16 4 macosx15 108 24 androidkitkat 1 1 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 17 mozilla 46 28 chrome89.0.4389.114 4 4 chrome104.0.0.0 8 8 android 1 1 chrome113.0.0.0 100 18 Unknown 138 138 chrome99.0.4859.172 2 2 chrome87.0.4280.88 16 4 chrome96.0.4664.110 6 4 chrome126.0.0.0 2 2 chrome91.0.4472.124 8 2 edge18 150 27 firefox122.0 2 2 chrome60.0.3112.107 2 2 chrome134.0.0.0 16 16 chrome63.0.3239.111 150 27 safari15.4 100 18 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 5 Mozilla/5.0_(compatible;_CensysInspect/1.1;__https://about.censys.io/) 20250428100631 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20250401041211 Mozilla/5.0_(compatible) 20250428112317 Mozilla/5.0_(compatible;_InternetMeasurement/1.0;__https://internet-measurement.com/) 20250413084203 Cpanel-HTTP-Client/1.0 20250430033921 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 2 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20250401041211 Cpanel-HTTP-Client/1.0 20250430033921 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 249 265 From1 2 2 From2 2 8 From3 0 0 From4 50 476 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 1 www_google_com 2 8 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 3 406 19 4294 409 10 830 404 164 74462 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 55 /old 8 - /newsite 2 - /src/.git/config 2 - /wp-admin/setup-config.php 1 - /old/.git/config 2 - /media../.git/config 2 - /dist/.git/config 2 - /admin/.git/config 2 - /site 2 - /test 8 - /www/.git/config 2 - /assets/.git/config 2 - /home 2 - /sahyadrimahavidyalaysawarde 2 www.google.com /api/.git/config 2 - /testing 6 - /files/.git/config 2 - /sandbox/.git/config 2 - /cms 2 - /laravel/.git/config 2 - /backend/.git/config 2 - /temp 2 www.google.com /new 8 - /wp 10 - /wordpress 10 - /source/.git/config 2 - /portal 2 - /dev/.git/config 2 - /main 6 - /dev 2 - /template/.git/config 2 - /scripts/.git/config 2 - /.aws/credentials 2 - /plugins/.git/config 2 - /frontend/.git/config 2 - /web 2 - /wp-admin/install.php 1 - /demo 2 - /lib/.git/config 2 - /tmp 2 - /docs/.git/config 2 - /staging/.git/config 2 - /ads.txt 8 - /blog 8 - /test/.git/config 2 - /logs/.git/config 2 - /panel/.git/config 2 - /wp-content/.git/config 2 - /app/.git/config 2 - /_profiler/phpinfo 2 - /js../.git/config 2 - /phpinfo 2 - /core/.git/config 2 - /backup 4 - /public/.git/config 2 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 60 216.10.248.154 136 136 8704 20250430033921 44.243.167.6 7 48 26095908 20250425015750 54.244.142.228 7 48 26095908 20250401143330 52.41.249.217 7 48 26095908 20250424022842 35.90.171.130 7 48 26095908 20250426025316 34.213.51.85 7 48 26095908 20250422004122 35.88.185.164 7 48 26095908 20250408020337 35.85.32.97 7 48 26095908 20250427031603 35.92.53.138 7 48 26095908 20250423021342 34.222.116.159 7 48 26095908 20250420214929 35.87.236.109 7 48 26095908 20250414110222 45.154.98.162 4 4 196588 20250425051544 162.142.125.125 4 6 58141 20250424051721 111.7.96.181 4 11 169458 20250411212021 167.94.145.99 4 6 58141 20250419030313 162.142.125.213 4 6 58141 20250428100631 44.200.39.86 4 4 55912 20250414145629 64.15.129.114 2 2 98294 20250403145956 81.88.53.43 2 2 27956 20250428020715 143.110.229.193 2 3 28447 20250423122743 44.243.104.220 2 2 27956 20250422000141 192.175.111.250 2 2 98294 20250403144214 199.45.154.135 2 4 30185 20250402112502 205.210.31.103 2 2 98294 20250401041211 64.15.129.112 2 2 98294 20250403145957 123.160.223.75 0 2 22003 35.90.7.247 2 2 27956 20250420214516 123.160.221.130 0 1 942 52.39.255.68 2 2 27956 20250425014325 145.220.91.19 2 2 27956 20250409005500 18.236.250.1 2 2 27956 20250408012503 54.218.240.44 2 2 27956 20250426024408 192.175.111.246 2 2 98294 20250403144215 192.241.152.207 2 3 28447 20250428112316 192.175.111.253 2 2 98294 20250403145954 192.175.111.236 2 2 98294 20250403144211 192.175.111.254 2 2 98294 20250403145953 185.247.137.139 0 1 1738 3.238.147.168 2 2 27956 20250404101236 185.247.137.5 2 2 27956 20250413084202 34.220.137.115 2 2 27956 20250427030700 123.160.221.132 0 1 2510 139.59.58.254 2 2 98294 20250401043051 35.90.163.185 2 2 27956 20250401142207 54.187.174.221 2 2 27956 20250424022717 64.15.129.101 2 2 98294 20250403144212 123.160.223.72 2 3 83001 20250417101008 13.39.84.235 2 2 27956 20250423095247 34.213.41.144 2 2 27956 20250423013852 123.160.223.73 0 1 32555 87.236.176.125 0 1 491 157.230.235.214 2 3 28447 20250409170010 199.45.154.125 2 4 30185 20250405092524 45.92.19.136 2 3 28447 20250417101003 147.124.223.62 1 1 13978 20250425101327 162.142.125.40 2 4 30185 20250401111335 54.149.185.2 2 2 27956 20250414105424 3.88.181.15 2 2 27956 20250414035458 176.126.103.148 2 8 141011 20250430011457 159.223.177.186 2 3 28447 20250414180915 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 30 20250401 27 70 26351405 8 20250402 6 8 30441 2 20250403 20 20 786608 9 20250404 6 6 28212 2 20250405 6 8 30441 2 20250406 4 4 256 1 20250407 4 4 256 1 20250408 13 54 26124120 3 20250409 8 9 56659 3 20250410 4 4 256 1 20250411 8 15 169714 2 20250412 4 4 256 1 20250413 6 8 30441 2 20250414 21 63 26236435 6 20250415 4 4 256 1 20250416 12 12 768 3 20250417 8 15 169714 3 20250418 4 4 256 1 20250419 8 10 58397 2 20250420 13 54 26124120 3 20250421 4 4 256 1 20250422 13 54 26124120 3 20250423 17 59 26180523 5 20250424 17 60 26182261 4 20250425 18 59 26334686 5 20250426 13 54 26124120 3 20250427 13 54 26124120 3 20250428 12 15 114800 4 20250429 4 4 256 1 20250430 6 12 141267 2 END_DAY # Session range - Number of visits BEGIN_SESSION 2 30s-2mn 1 0s-30s 86 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 74 / 117 2479482 53 43 /assets/vendor/remixicon/remixicon.woff2 10 1252680 0 3 /assets/vendor/fontawesome-free/webfonts/fa-regular-400.woff2 10 252360 0 2 /assets/vendor/bootstrap-icons/fonts/bootstrap-icons.woff2 10 1212960 0 0 /assets/vendor/boxicons/fonts/boxicons.woff2 10 1156800 0 5 /assets/vendor/fontawesome-free/webfonts/fa-solid-900.woff2 10 1505160 0 0 /.well-known/acme-challenge/RY8XSWMQJL-3K48WKHBXA--0DH882KWD 2 128 0 1 /.well-known/acme-challenge/MOKD2LQKH37QI0YN0G8OA5BVETP0W_XJ 2 128 0 1 /.well-known/acme-challenge/61YX-25ELI8T7IHNKPNDY95IB2OM8Z3P 2 128 0 1 /.well-known/acme-challenge/ZQ55SQD1WEQNVMJI522APNZFEX0CH67Z 2 128 0 1 /.well-known/acme-challenge/T9GPBM952NKHJJOTN35RN3JRXP1660TM 2 128 0 1 /.well-known/acme-challenge/6GZL7NQY735WPSPHTYLEEW6SEBHUQWDN 2 128 0 1 /.well-known/acme-challenge/33B5Q5HJENCVS-Q73071U0CYYCITQIVO 2 128 0 1 /.well-known/acme-challenge/9TWRC2HQ7HYQQCI8PQ0V_HVL5YTTJNVS 2 128 0 1 /.well-known/acme-challenge/XRWT3INFS17SZ39N49AXLH-4JLZZ31NE 2 128 1 0 /.well-known/acme-challenge/1WMIUQYNFOES7TZQ6ACEP5EEI5VTXFKG 2 128 0 1 /.well-known/acme-challenge/27N29NVNC2517NAOBMZR42WD2BSHHD3Y 2 128 1 0 /.well-known/acme-challenge/3HN4EY2K0_XPAB4GXDNCZUDB6TY0DILD 2 128 0 1 /.well-known/acme-challenge/96TPVK2J48L0PE74WANM9ZF--QB8VD-P 2 128 0 1 /.well-known/acme-challenge/2HZ1FOEA8BZE_R82QMNFPSYX9R3FE2A6 2 128 1 0 /.well-known/acme-challenge/ZR0HH8PDA39OM1YPQX7238XU_8_JGAA5 2 128 0 1 /.well-known/acme-challenge/M6_SWHZMJE-0GKCDT8SBIJKWRU4X2KS9 2 128 1 0 /.well-known/acme-challenge/NS14IAHNZJLP1K10WM-GNH4UETQD_8WG 2 128 1 0 /.well-known/acme-challenge/GN8H8VZCOZC5AF_YZ4NEA6KOWM98LNZF 2 128 0 1 /.well-known/acme-challenge/SVL-IY1-MIOJU3H5ABHW76AQB1CRPPZY 2 128 0 1 /.well-known/acme-challenge/ODHHCKR38GPB684JUR0KWFV2O-UB90_X 2 128 0 1 /.well-known/acme-challenge/ACJ6FVPSJ3K6GP0LIV5N9FL8HWKABMWT 2 128 1 0 /.well-known/acme-challenge/N8095SWAP6VZW3MOBXO3KIFWO039OSFD 2 128 1 0 /.well-known/acme-challenge/IF7NWUKHI0TOLGO5-EL1C6U7LYO4AA87 2 128 1 0 /.well-known/acme-challenge/O_UKGRN2EHL3RY-YOLFNV-9B2V2Z92Z2 2 128 1 0 /.well-known/acme-challenge/8J8ZKST4WEGLAT-8OU3TJMG_CSMOC4K0 2 128 0 1 /.well-known/acme-challenge/-3AR8F95KU03SQCHXYN6VONFHMJJQY-8 2 128 0 1 /.well-known/acme-challenge/49PR24NWR099QD274XH3DI8LXGK-AWCF 2 128 0 1 /.well-known/acme-challenge/JDJ200N9B8F8__VM79DO8PDB6H43AT4G 2 128 1 0 /.well-known/acme-challenge/Z3E1__EEBHT2005FI3HXS1X-JAMVY384 2 128 1 0 /.well-known/acme-challenge/PH2WIHK604AWB22N35T0MCBSB138NU4O 2 128 0 1 /.well-known/acme-challenge/K5C_6FMK5FSJOYXOGZTNGLDTVODS2QU7 2 128 1 0 /.well-known/acme-challenge/I1BTNLQTP2SY2SSR2OC0F-RQGSC0WAXR 2 128 0 1 /.well-known/acme-challenge/IXDIIWQGMSUCP70IRTDDP5OQR5ULWC7B 2 128 1 0 /.well-known/acme-challenge/7U3W0U7GL29-9O0NJ19OISPJC0KJ54PX 2 128 1 0 /.well-known/acme-challenge/XK5TPVO0KVIAXQXQ4D13LSN1Y_BPBM-5 2 128 1 0 /.well-known/acme-challenge/3V9J6_W3U6LLIJDS07JV91DY3UWR3VME 2 128 1 0 /.well-known/acme-challenge/7UT6P8ZCTX_-J11CPOGLAI4PTYJSARUU 2 128 1 0 /.well-known/acme-challenge/J6OFLQCDPIP2Z_KVKRRJ1NPDMDZN1_E0 2 128 1 0 /.well-known/acme-challenge/0XEWRLO1_I4267C3_J-6I1AGV9W-Z7N7 2 128 0 1 /.well-known/acme-challenge/0LA5DX1A0IBB5LJBPMPDZ2LMMZQ2D3XN 2 128 1 0 /.well-known/acme-challenge/CB1I5_XGFNUSX4CK-P2PJ9TP4_BX3OAA 2 128 1 0 /.well-known/acme-challenge/I7Y71089TFE4VVIX3LWE5S0099CL7HPS 2 128 0 1 /.well-known/acme-challenge/VXXC1J1FJ0AAXG5MWI05VZ8A3TSM-H8N 2 128 1 0 /.well-known/acme-challenge/5O6DF8-BT2CD2DN6__M8I6KS3OR40VHT 2 128 1 0 /.well-known/acme-challenge/6JUS2LHXZ04D8VN626AGPSOC2GZK80S3 2 128 0 1 /.well-known/acme-challenge/I6X5GAA800G7FEU5UIYW4OBC1Q772ENP 2 128 1 0 /.well-known/acme-challenge/GI4L5EYEQ8DN0GEOFJSB-USKS_KA27ZK 2 128 0 1 /.well-known/acme-challenge/9I87N2-W2CQKBI56MXULWNC88U2LJYDC 2 128 0 1 /.well-known/acme-challenge/A4UHVIQN71MGT-I3MW6RVBCOQFWC00GH 2 128 0 1 /.well-known/acme-challenge/G3TY5I-JENGITN7JI66U744FB5I1Q3_8 2 128 1 0 /.well-known/acme-challenge/2BW6PXPF0QJBZRKTJYV1-6C0BXKAMUQ- 2 128 0 1 /.well-known/acme-challenge/VI8RK7KGOPSCTWO6M04PPNEFG1TE975_ 2 128 1 0 /.well-known/acme-challenge/1FU2D8Z37AJ142G-S7HYO71RNT-T2P7S 2 128 0 1 /.well-known/acme-challenge/YKXDY7WUIY374-XDURKTP_S_ZCI2AC-U 2 128 1 0 /.well-known/acme-challenge/RQCTFW40UOVD-F6D2K9NAFYUK48EPKB6 2 128 0 1 /.well-known/acme-challenge/95U_MMUZOJVB11Y31G8JX-XQFF2C2893 2 128 0 1 /.well-known/acme-challenge/ZDXT586QM36_FS7D_T4WTJEP-1Z5375Y 2 128 1 0 /.well-known/acme-challenge/D29_X5U6RJTE5N_K1VQ77DUWCR7HN0HW 2 128 1 0 /.well-known/acme-challenge/DTC4FD3O1H1V_LVA9ST8K39U-COTRTQI 2 128 0 1 /.well-known/acme-challenge/OHX-BFPI5R15L6FG1ZXMXYQUB9R3-6XE 2 128 1 0 /.well-known/acme-challenge/34YO0DJEE9Z8AQ5KP3M66S-VOB05WJ3K 2 128 1 0 /.well-known/acme-challenge/A1CITQD2BE237MFG-JXOFU-0L_8XX54D 2 128 1 0 /.well-known/acme-challenge/JBP-LT8Z6IHWN3-6U245ZUOI1B6-6XCB 2 128 0 1 /.well-known/acme-challenge/GM5KP8AW1ZFAWYEXXEDDN85XLMV2KYBW 2 128 1 0 /.well-known/acme-challenge/EX-ZBNJZO-3BPG5JN4ZU_04LFNVFDPDL 2 128 1 0 /.well-known/acme-challenge/2AN6H7OR9UPIH7GFFKC3LAYORB5Q6NWR 2 128 1 0 /.well-known/acme-challenge/06E0PTI7K6Y4WVDABHF78ZDUB98FH6T4 2 128 0 1 /.well-known/acme-challenge/I6GSR777B0S6C-OEX1J9YFF_0IEFA4U3 2 128 0 1 END_SIDER # Payload Range - Payload Frequency BEGIN_FILESIZE 6 500-1K 87 2K-5K 23 5K+ 552 100-500 144 1K-2K 20 44-100 146 END_FILESIZE