AWSTATS DATA FILE 7.9 (build 20230108) # If you remove this file, all statistics for date 202504 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/awstats.testsahyadrimahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2075 POS_TIME 2734 POS_VISITOR 8638 POS_DAY 9049 POS_DOMAIN 3335 POS_LOGIN 3604 POS_ROBOT 3759 POS_WORMS 3891 POS_EMAILSENDER 4022 POS_EMAILRECEIVER 4165 POS_SESSION 9223 POS_FILESIZE 9818 POS_SIDER 9379 POS_FILETYPES 4300 POS_DOWNLOADS 4415 POS_OS 4463 POS_BROWSER 4569 POS_SCREENSIZE 4686 POS_UNKNOWNREFERER 4760 POS_UNKNOWNREFERERBROWSER 4988 POS_ORIGIN 5108 POS_SEREFERRALS 5240 POS_PAGEREFS 5384 POS_SEARCHWORDS 5532 POS_KEYWORDS 5684 POS_MISC 2397 POS_ERRORS 5743 POS_CLUSTER 3460 POS_SIDER_404 5914 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20250501150743 1 0 8237667063635 FirstTime 0 LastTime 20250426192948 LastUpdate 20250501184918 1 0 0 0 0 TotalVisits 10 TotalUnique 9 MonthHostsKnown 0 MonthHostsUnknown 9 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 AddToFavourites 0 18 0 RealPlayerSupport 0 0 0 WindowsMediaPlayerSupport 0 0 0 FlashSupport 0 0 0 QuickTimeSupport 0 0 0 JavascriptDisabled 0 0 0 PDFSupport 0 0 0 TotalMisc 0 0 0 DirectorSupport 0 0 0 JavaEnabled 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 6 6 1527 190 205 6646960 1 0 0 0 0 0 0 2 0 0 0 8 10 83632 3 12 12 952 66 68 8183347 4 0 0 0 8 12 0 5 0 0 0 8 8 167264 6 0 0 0 9 11 226 7 0 0 0 14 15 226 8 8 8 2243 314 342 11373362 9 0 0 0 18 22 0 10 0 0 0 11 11 157 11 0 0 0 10 10 0 12 0 0 0 6 6 83632 13 0 0 0 8 8 126648 14 0 0 0 10 12 0 15 2 2 496 20 20 0 16 0 0 0 73 75 1425086 17 0 0 0 12 12 0 18 0 0 0 10 10 0 19 2 2 716 150 163 4885644 20 0 0 0 36 38 1075595 21 0 0 0 8 8 0 22 0 0 0 10 11 226 23 0 0 0 32 32 4110096 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 5 sc 16 16 4486 us 8 8 604 zz 2 2 174 ca 2 2 174 jp 2 2 496 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 0 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 3 Unknown 18 2972 0 0 php 6 1034 0 0 html 6 1928 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 0 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 3 ios_iphone 2 2 win10 16 16 Unknown 12 12 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 4 mozilla 8 8 chrome91.0.4472.124 16 16 Unknown 4 4 safari13.0.3 2 2 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 2 Mozilla/5.0_(compatible;_Let's_Encrypt_validation_server;__https://www.letsencrypt.org) 20250409034322 Cpanel-HTTP-Client/1.0 20250409034315 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 1 Cpanel-HTTP-Client/1.0 20250409034315 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 30 30 From1 0 0 From2 0 0 From3 0 0 From4 0 0 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 8 406 85 19210 405 4 168 409 46 4935 403 16 5728 301 256 0 500 4 4260 502 1 157 404 679 38127643 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 121 /config.env 2 - /database.json 4 - /bitrix/php_interface/dbconn.php 4 - /.git/refs/ 8 - /backup.env 8 - /new/.env.staging 2 - /phpinfo.php 6 - /.git/logs/ 8 - /app/etc/env.php 4 - /web/config.php 4 - /local_settings.py 8 - /main 12 - /core/install.php 4 - /Dockerfile 8 - /var/log/exception.log 4 - /sites/all/themes/ 8 - /secure-config.json 4 - /.env.test 8 - /.git/index 8 - /.git/packed-refs 8 - /config/production.json 4 - /config/routes.yaml 4 - /phpinfo 4 - /app/etc/local.xml 8 - /.npmrc 8 - /config/database.yml 8 - /bootstrap/cache/config.php 4 - /auth.json 4 - /var/logs/prod.log 4 - /old 10 - /application.yml 4 - /application.properties 2 - /test.php 6 - /package.json 4 - /testing 4 - /api/config.json 4 - /.git/objects/ 8 - /api/credentials 8 - /helm/values.yaml 8 - /.git/config 22 - /db.ini 8 - /i.php 2 - /CHANGELOG.txt 4 - /storage/logs/laravel.log 4 - /.env.production 8 - /test 4 - /config/secrets.yml 4 - /config/app.php 4 - /development.env 8 - /api-docs 8 - /swagger-ui.js 1 - /wordpress 14 - /config.inc.php 4 - /aws/credentials 2 - /.aws/config 2 - /debug.php 4 - /backup/config.php 4 - /.env.example 10 - /.dockerignore 8 - /settings.yaml 8 - /var/log/system.log 2 - /api/config.env 2 - /secrets.json 4 - /staging.env 8 - /blog 4 - /sftp-config.json 1 - /.gitignore 8 - /phpinfo2.php 4 - /pi.php 2 - /cgi-bin/phpinfo.php 4 - /sendgrid.env 2 - /wp 8 - /.env.local 10 - /.git/logs/HEAD 8 - /new/.env.local 2 - /phpinfo1.php 4 - /_profiler/phpinfo 4 - /config.js 4 - /.vscode/sftp.json 1 - /config/packages/ 8 - /src/config.js 4 - /config/secrets.json 3 - /joomla/configuration.php-dist 4 - /wp-content/debug.log 2 - /server.js 4 - /yarn.lock 8 - /admin/phpinfo.php 2 - /.env.dev 8 - /logs/error.php 4 - /.aws/credentials 12 - /sites/default/settings.php 4 - /composer.json 4 - /.git/HEAD 20 - /wordpress/wp-admin/setup-config.php 1 - /var/logs/dev.log 4 - /config/default.json 3 - /storage/framework/cache/ 8 - /typo3conf/localconf.php 4 - /app.js 4 - /swagger/ui/index 2 - /swagger.json 4 - /swagger-ui/swagger-ui.js 1 - /info.php 6 - /.well-known/security.txt 8 - /index.html 2 - /.env.stage 2 - /.git/branches/ 8 - /env.txt 8 - /storage/framework/sessions/ 8 - /new 4 - /prod.env 8 - /credentials.env 8 - /.svn/entries 8 - /stage.env 8 - /php.php 2 - /swagger-ui.html 8 - /openapi.json 4 - /sites/all/modules/ 8 - /nova-api/styles 8 - /aws-secret.yaml 2 - /storage/framework/views/ 8 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 9 154.83.103.207 6 6 1527 20250413085756 154.83.103.111 6 6 1527 20250412000527 216.10.248.154 4 4 256 20250409034315 154.83.103.210 4 4 1432 20250426192948 23.178.112.217 2 2 174 20250409034321 35.167.207.124 2 2 174 20250409034322 47.129.181.151 2 2 174 20250409034322 3.15.12.225 2 2 174 20250409034322 43.130.67.6 2 2 496 20250402151209 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 6 20250402 2 2 496 1 20250409 12 12 952 5 20250412 6 6 1527 1 20250413 6 6 1527 1 20250425 2 2 716 1 20250426 2 2 716 1 END_DAY # Session range - Number of visits BEGIN_SESSION 2 30s-2mn 2 0s-30s 8 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 9 /.well-known/acme-challenge/hGv4ETJLikKR4EiTKlhMo3lyukc1YdUFJI1YpMukn84 8 696 4 4 /wp-config.php 4 0 2 0 /cgi-sys/403.html 4 1432 2 0 /server-status 4 1432 0 2 /wp-json/wp/v2/users 2 588 0 2 /.well-known/acme-challenge/W91VUSDJIWTFIZMF6F2IXSURGPEVILN8 2 128 0 1 /.well-known/acme-challenge/YBLBA0VQIX1OICI0A-MYZH9JD4ZAV9A5 2 128 1 0 /wp-admin/install.php 2 1034 0 0 / 2 496 1 1 END_SIDER # Payload Range - Payload Frequency BEGIN_FILESIZE 6 44-100 57 1K-2K 5 5K+ 679 0-44 282 500-1K 2 100-500 114 END_FILESIZE