AWSTATS DATA FILE 7.8 (build 20200416) # If you remove this file, all statistics for date 202405 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/awstats.testsahyadrimahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2041 POS_TIME 2699 POS_VISITOR 6222 POS_DAY 6333 POS_DOMAIN 3296 POS_LOGIN 3520 POS_ROBOT 3675 POS_WORMS 3895 POS_EMAILSENDER 4026 POS_EMAILRECEIVER 4169 POS_SESSION 6410 POS_SIDER 6556 POS_FILETYPES 4304 POS_DOWNLOADS 4385 POS_OS 4433 POS_BROWSER 4508 POS_SCREENSIZE 4574 POS_UNKNOWNREFERER 4648 POS_UNKNOWNREFERERBROWSER 4735 POS_ORIGIN 4817 POS_SEREFERRALS 4947 POS_PAGEREFS 5091 POS_SEARCHWORDS 5239 POS_KEYWORDS 5391 POS_MISC 2363 POS_ERRORS 5450 POS_CLUSTER 3376 POS_SIDER_404 5585 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20240601214743 1 0 8278095093182 FirstTime 0 LastTime 20240517224436 LastUpdate 20240602183308 1 0 0 0 0 TotalVisits 1 TotalUnique 1 MonthHostsKnown 0 MonthHostsUnknown 1 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 PDFSupport 0 0 0 WindowsMediaPlayerSupport 0 0 0 FlashSupport 0 0 0 TotalMisc 0 0 0 JavaEnabled 0 0 0 JavascriptDisabled 0 0 0 DirectorSupport 0 0 0 QuickTimeSupport 0 0 0 AddToFavourites 0 0 0 RealPlayerSupport 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 0 0 0 27 27 578842 1 0 0 0 35 35 884910 2 0 0 0 3 3 83 3 0 0 0 38 38 884930 4 0 0 0 35 35 909124 5 0 0 0 0 0 0 6 0 0 0 37 37 905922 7 0 0 0 37 37 886196 8 0 0 0 37 37 902800 9 0 0 0 2 2 0 10 0 0 0 40 40 884827 11 0 0 0 2 2 0 12 0 0 0 1 1 83 13 0 0 0 12 12 0 14 0 0 0 138 138 3637595 15 0 0 0 37 37 920266 16 0 0 0 35 37 909855 17 0 0 0 37 37 911092 18 0 0 0 33 33 920266 19 0 0 0 10 10 0 20 0 0 0 1 1 83 21 0 0 0 36 36 920349 22 3 3 83288 39 39 981559 23 0 0 0 5 5 83 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 1 ua 3 3 83288 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 2 Go\-http\-client/ 70 22884 20240530182215 0 bot[\s_+:,\.\;\/\\-] 2 246 20240511165129 2 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 1 html 3 83288 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 0 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 1 linux 3 3 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 1 firefox95.0 3 3 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 0 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 0 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 3 3 From1 0 0 From2 0 0 From3 0 0 From4 0 0 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 5 302 1 0 404 391 16010588 301 184 0 406 18 4068 409 13 1079 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 14 /telescope/requests 34 - /login.action 36 - /.git/config 34 - /.DS_Store 36 - /s/730323e2834323e20313e2631323/_/ 34 - /config.json 17 - /.vscode/sftp.json 18 - /ecp/Current/exporttool/microsoft.exchange.ediscovery.exporttool.application 36 - / 1 - /debug/default/view 36 - /server 36 - /v2/_catalog 36 - /// 1 - /_all_dbs 36 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 1 95.216.17.109 3 3 83288 20240517224436 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 1 20240517 3 3 83288 1 END_DAY # Session range - Number of visits BEGIN_SESSION 1 0s-30s 1 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 3 //wp-json/wp/v2/users/ 1 294 0 1 // 1 41497 0 0 / 1 41497 1 0 END_SIDER