AWSTATS DATA FILE 7.9 (build 20230108) # If you remove this file, all statistics for date 202505 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/awstats.adhyapakmahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2071 POS_TIME 2733 POS_VISITOR 7115 POS_DAY 7273 POS_DOMAIN 3295 POS_LOGIN 3522 POS_ROBOT 3677 POS_WORMS 3840 POS_EMAILSENDER 3971 POS_EMAILRECEIVER 4114 POS_SESSION 7377 POS_FILESIZE 7847 POS_SIDER 7523 POS_FILETYPES 4249 POS_DOWNLOADS 4350 POS_OS 4398 POS_BROWSER 4475 POS_SCREENSIZE 4551 POS_UNKNOWNREFERER 4625 POS_UNKNOWNREFERERBROWSER 4712 POS_ORIGIN 4794 POS_SEREFERRALS 4926 POS_PAGEREFS 5070 POS_SEARCHWORDS 5218 POS_KEYWORDS 5370 POS_MISC 2396 POS_ERRORS 5429 POS_CLUSTER 3378 POS_SIDER_404 5565 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20250601142456 3 274 14035681746617 FirstTime 0 LastTime 20250506013454 LastUpdate 20250601151907 3 0 2 0 0 TotalVisits 2 TotalUnique 2 MonthHostsKnown 0 MonthHostsUnknown 2 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 DirectorSupport 0 0 0 PDFSupport 0 0 0 FlashSupport 0 0 0 QuickTimeSupport 0 0 0 TotalMisc 0 0 0 JavascriptDisabled 0 0 0 RealPlayerSupport 0 0 0 AddToFavourites 0 10 0 JavaEnabled 0 0 0 WindowsMediaPlayerSupport 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 0 0 0 2 4 0 1 14 14 222836 136 151 1947194 2 0 0 0 0 0 0 3 14 14 222836 124 137 1872903 4 0 0 0 4 6 452 5 0 0 0 8 10 36962 6 0 0 0 2 2 0 7 0 0 0 6 6 36962 8 0 0 0 8 12 220 9 0 0 0 0 0 0 10 0 0 0 13 13 74602 11 0 0 0 8 8 452 12 0 0 0 4 4 0 13 0 0 0 2 2 0 14 0 0 0 12 14 36962 15 0 0 0 0 0 0 16 0 0 0 0 0 0 17 0 0 0 4 4 36962 18 0 0 0 2 2 0 19 0 0 0 11 11 148074 20 0 0 0 6 6 36962 21 0 0 0 1 1 226 22 0 0 0 20 20 0 23 0 0 0 4 4 36962 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 1 sc 28 28 445672 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 1 unknown 2 220 20250525082904 2 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 2 html 26 444956 0 0 Unknown 2 716 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 0 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 1 win10 28 28 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 1 chrome91.0.4472.124 28 28 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 0 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 0 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 28 28 From1 0 0 From2 0 0 From3 0 0 From4 0 0 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 5 409 37 3071 404 230 4251152 301 92 0 406 38 8588 403 8 2864 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 65 /stage.env 4 - /Dockerfile 4 - /.git/refs/ 4 - /swagger.json 2 - /phpinfo 2 - /database.json 2 - /credentials.env 4 - /.git/branches/ 4 - /helm/values.yaml 4 - /.git/index 4 - /config/database.yml 4 - /.env.production 4 - /secrets.json 2 - /.env.local 4 - /config/default.json 2 - /config.js 2 - /.env.dev 4 - /yarn.lock 4 - /api-docs 4 - /.env.test 4 - /config/secrets.json 2 - /wp-content/debug.log 2 - /.git/logs/HEAD 4 - /.gitignore 4 - /package.json 2 - /var/log/exception.log 2 - /var/logs/prod.log 2 - /api/credentials 4 - /staging.env 4 - /src/config.js 2 - /./.git/config 1 - /development.env 4 - /.git/HEAD 12 - /db.ini 4 - /secure-config.json 2 - /.env.example 4 - /.git/config 19 - /app/etc/local.xml 4 - /.dockerignore 4 - /.vscode/sftp.json 2 - /.git/packed-refs 4 - /api/config.json 2 - /openapi.json 2 - /.git/objects/ 4 - /sftp-config.json 2 - /local_settings.py 4 - /app.js 2 - /.git/logs/ 4 - /var/logs/dev.log 2 - /.well-known/security.txt 4 - /.svn/entries 4 - /env.txt 4 - /prod.env 4 - /composer.json 2 - /.npmrc 4 - /auth.json 2 - /storage/logs/laravel.log 2 - /backup.env 4 - /server.js 2 - /ads.txt 2 - /swagger-ui.html 4 - /settings.yaml 4 - /nova-api/styles 4 - /config/production.json 2 - /.aws/credentials 4 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 2 154.83.103.201 14 14 222836 20250506013454 154.83.103.202 14 14 222836 20250503035314 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 2 20250503 14 14 222836 1 20250506 14 14 222836 1 END_DAY # Session range - Number of visits BEGIN_SESSION 1 0s-30s 2 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 8 /storage/framework/sessions/ 4 74040 0 0 /storage/framework/views/ 4 74040 0 0 /sites/all/modules/ 4 74040 0 0 /storage/framework/cache/ 4 74040 0 0 /sites/all/themes/ 4 74040 0 2 /config/packages/ 4 74040 0 0 /server-status 2 716 0 0 /cgi-sys/403.html 2 716 2 0 END_SIDER # Payload Range - Payload Frequency BEGIN_FILESIZE 4 100-500 52 44-100 37 0-44 102 5K+ 254 END_FILESIZE