AWSTATS DATA FILE 7.9 (build 20230108) # If you remove this file, all statistics for date 202505 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/awstats.testsahyadrimahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2075 POS_TIME 2734 POS_VISITOR 7252 POS_DAY 7362 POS_DOMAIN 3286 POS_LOGIN 3508 POS_ROBOT 3663 POS_WORMS 3826 POS_EMAILSENDER 3957 POS_EMAILRECEIVER 4100 POS_SESSION 7437 POS_FILESIZE 7697 POS_SIDER 7583 POS_FILETYPES 4235 POS_DOWNLOADS 4332 POS_OS 4380 POS_BROWSER 4455 POS_SCREENSIZE 4529 POS_UNKNOWNREFERER 4603 POS_UNKNOWNREFERERBROWSER 4690 POS_ORIGIN 4772 POS_SEREFERRALS 4902 POS_PAGEREFS 5046 POS_SEARCHWORDS 5194 POS_KEYWORDS 5346 POS_MISC 2398 POS_ERRORS 5405 POS_CLUSTER 3364 POS_SIDER_404 5542 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20250601153614 1 0 16945155067736 FirstTime 0 LastTime 20250502000130 LastUpdate 20250601183725 1 0 0 0 0 TotalVisits 1 TotalUnique 1 MonthHostsKnown 0 MonthHostsUnknown 1 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 WindowsMediaPlayerSupport 0 0 0 QuickTimeSupport 0 0 0 FlashSupport 0 0 0 AddToFavourites 0 8 0 DirectorSupport 0 0 0 JavascriptDisabled 0 0 0 RealPlayerSupport 0 0 0 TotalMisc 0 0 0 PDFSupport 0 0 0 JavaEnabled 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 2 2 716 161 176 4892372 1 0 0 0 6 6 83632 2 0 0 0 4 4 452 3 0 0 0 8 8 0 4 0 0 0 27 27 82640 5 0 0 0 10 12 0 6 0 0 0 4 4 0 7 0 0 0 6 10 81730 8 0 0 0 6 6 0 9 0 0 0 10 10 81730 10 0 0 0 12 12 83632 11 0 0 0 16 16 81730 12 0 0 0 13 17 472 13 0 0 0 6 6 81730 14 0 0 0 0 0 0 15 0 0 0 15 15 226 16 0 0 0 8 8 0 17 0 0 0 16 16 0 18 0 0 0 6 7 226 19 0 0 0 16 18 81730 20 0 0 0 6 6 0 21 0 0 0 6 6 0 22 0 0 0 6 6 81730 23 0 0 0 4 4 0 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 1 sc 2 2 716 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 1 unknown 2 246 20250506122435 2 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 2 Unknown 1 358 0 0 html 1 358 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 0 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 1 win10 2 2 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 1 chrome91.0.4472.124 2 2 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 0 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 0 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 2 2 From1 0 0 From2 0 0 From3 0 0 From4 0 0 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 5 404 135 5624878 403 4 1432 409 22 1826 406 25 5650 301 204 0 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 71 /storage/framework/cache/ 2 - /swagger.json 1 - /storage/logs/laravel.log 1 - /Dockerfile 2 - /secrets.json 1 - /.aws/credentials 2 - /config/production.json 1 - /settings.yaml 2 - /.git/refs/ 2 - /api/config.json 1 - /.env.example 2 - /.git/objects/ 2 - /config/database.yml 2 - /sendgrid.env 2 - /secure-config.json 1 - /prod.env 2 - /storage/framework/sessions/ 2 - /nova-api/styles 2 - /.git/index 2 - /.svn/entries 2 - /.git/HEAD 4 - /app/etc/local.xml 2 - /development.env 2 - /.git/packed-refs 2 - /package.json 1 - /.git/branches/ 2 - /sites/all/themes/ 2 - /db.ini 2 - /.git/config 10 - /composer.json 1 - /config/packages/ 2 - /config/secrets.json 1 - /.env.local 2 - /src/config.js 1 - /server.js 1 - /openapi.json 1 - /sites/all/modules/ 2 - /.well-known/security.txt 2 - /config/default.json 1 - /.npmrc 2 - /var/logs/prod.log 1 - /local_settings.py 2 - /phpinfo 4 - /config.js 1 - /.gitignore 2 - /env.txt 2 - /auth.json 1 - /.env.test 2 - /var/logs/dev.log 1 - /api-docs 2 - /.vscode/sftp.json 2 - /var/log/exception.log 1 - /database.json 1 - /api/credentials 2 - /.git/logs/ 2 - /.git/logs/HEAD 2 - /.dockerignore 2 - /.env.production 2 - /stage.env 2 - /app.js 1 - /ads.txt 4 - /wp-content/debug.log 1 - /yarn.lock 2 - /helm/values.yaml 2 - /.env.dev 2 - /staging.env 2 - /sftp-config.json 2 - /backup.env 2 - /storage/framework/views/ 2 - /swagger-ui.html 2 - /credentials.env 2 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 1 154.83.103.108 2 2 716 20250502000130 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 1 20250502 2 2 716 1 END_DAY # Session range - Number of visits BEGIN_SESSION 1 0s-30s 1 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 2 /cgi-sys/403.html 1 358 1 0 /server-status 1 358 0 1 END_SIDER # Payload Range - Payload Frequency BEGIN_FILESIZE 4 5K+ 135 0-44 212 100-500 33 44-100 22 END_FILESIZE