AWSTATS DATA FILE 7.8 (build 20200416) # If you remove this file, all statistics for date 202306 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/awstats.testsahyadrimahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2041 POS_TIME 2713 POS_VISITOR 7545 POS_DAY 8159 POS_DOMAIN 3247 POS_LOGIN 3511 POS_ROBOT 3666 POS_WORMS 3912 POS_EMAILSENDER 4043 POS_EMAILRECEIVER 4186 POS_SESSION 8403 POS_SIDER 8550 POS_FILETYPES 4321 POS_DOWNLOADS 4449 POS_OS 4497 POS_BROWSER 4617 POS_SCREENSIZE 4828 POS_UNKNOWNREFERER 4902 POS_UNKNOWNREFERERBROWSER 5686 POS_ORIGIN 6175 POS_SEREFERRALS 6307 POS_PAGEREFS 6451 POS_SEARCHWORDS 6599 POS_KEYWORDS 6751 POS_MISC 2377 POS_ERRORS 6810 POS_CLUSTER 3367 POS_SIDER_404 6935 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20230702175321 1 0 13961462320236 FirstTime 20230607122845 LastTime 20230623180121 LastUpdate 20230702181053 1 0 0 0 0 TotalVisits 17 TotalUnique 14 MonthHostsKnown 0 MonthHostsUnknown 14 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 WindowsMediaPlayerSupport 0 0 0 QuickTimeSupport 0 0 0 TotalMisc 0 0 0 AddToFavourites 0 2 0 PDFSupport 0 0 0 FlashSupport 0 0 0 RealPlayerSupport 0 0 0 DirectorSupport 0 0 0 JavaEnabled 0 0 0 JavascriptDisabled 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 0 0 0 0 0 0 1 0 0 0 0 0 0 2 0 0 0 0 0 0 3 0 0 0 2 2 71824 4 2 2 18248 0 0 0 5 3 4 22367 0 2 0 6 0 0 0 0 0 0 7 0 0 0 2 2 71866 8 2 2 18248 0 0 0 9 2 2 71824 0 0 0 10 0 0 0 0 0 0 11 0 0 0 0 0 0 12 5 5 389 22 24 7836 13 6 6 82800 1 1 13800 14 2 2 0 2 2 0 15 2 2 18248 0 0 0 16 0 0 0 0 0 0 17 2 2 71866 0 0 0 18 2 2 71824 0 0 0 19 0 0 0 0 0 0 20 4 4 18264 0 2 260 21 0 0 0 0 0 0 22 0 0 0 0 0 0 23 0 0 0 0 0 0 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 4 us 23 24 160229 ca 6 6 215514 be 2 2 18248 zz 1 1 87 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 3 no_user_agent 4 143690 20230625030207 0 unknown 2 260 20230622204333 2 Go\-http\-client/ 1 13800 20230607130148 0 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 4 html 22 389570 0 0 php 5 0 0 0 Unknown 5 389 0 0 png 1 4119 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 0 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 5 win7 2 2 win10 4 4 macosx6 2 2 Unknown 21 20 linux 4 4 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 8 chrome79.0.3945.79 2 2 chrome108.0.0.0 2 2 Unknown 13 13 chrome83.0.4103.61 2 2 chrome104.0.0.0 2 2 mozilla 8 7 chrome112.0.5615.121 2 2 chrome84.0.4147.105 2 2 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 6 Mozilla/5.0_(compatible;_CensysInspect/1.1;__https://about.censys.io/) 20230618052714 Cpanel-HTTP-Client/1.0 20230607122845 Mozilla/5.0_(compatible;_Let's_Encrypt_validation_server;__https://www.letsencrypt.org) 20230607122853 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20230623180121 WordPress/6.2.2;_https://testsahyadrimahavidyalay.ptechinstitute.com 20230622204339 Mozilla/5.0_(compatible;_InternetMeasurement/1.0;__https://internet-measurement.com/) 20230609040047 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 3 Cpanel-HTTP-Client/1.0 20230607122845 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20230623180121 WordPress/6.2.2;_https://testsahyadrimahavidyalay.ptechinstitute.com 20230622204339 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 32 32 From1 0 0 From2 0 0 From3 0 0 From4 0 1 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 5 403 8 3314 406 1 226 101 1 0 301 2 0 404 12 4296 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 12 /debug/default/view 1 - /v2/_catalog 1 - /.DS_Store 1 - /about 1 - /login.action 1 - /_all_dbs 1 - /s/730323e2834323e20313e2631323/_/ 1 - /config.json 1 - /ecp/Current/exporttool/microsoft.exchange.ediscovery.exporttool.application 1 - /.git/config 1 - /.vscode/sftp.json 1 - /telescope/requests 1 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 14 216.10.248.154 7 7 128 20230622204339 205.169.39.232 4 4 55200 20230607132354 205.210.31.216 2 2 71824 20230623091100 65.154.226.166 2 2 27600 20230607132529 167.94.138.52 2 3 22367 20230618052711 198.235.24.129 2 2 71866 20230620174342 35.211.139.15 2 2 18264 20230622204323 198.235.24.182 2 2 71824 20230623180121 170.64.146.49 2 2 18248 20230610153137 87.236.176.128 2 2 18248 20230609040047 3.88.224.90 2 2 18248 20230613080728 3.145.146.248 1 1 87 20230607122851 35.162.213.66 1 1 87 20230607122853 23.178.112.107 1 1 87 20230607122851 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 9 20230607 11 11 83189 6 20230608 2 2 0 1 20230609 2 2 18248 1 20230610 2 2 18248 1 20230613 2 2 18248 1 20230618 3 4 22367 2 20230620 2 2 71866 1 20230622 4 4 18264 2 20230623 4 4 143648 2 END_DAY # Session range - Number of visits BEGIN_SESSION 1 0s-30s 17 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 5 / 22 389570 10 10 /wp-cron.php 5 0 3 3 /.well-known/acme-challenge/F-_gDf9Z3GNDfYxzTV6Bg1k4sBkMjFcv-9HWskaQw_s 3 261 3 3 /.well-known/acme-challenge/X005KIE4O6KR7WZP8YPPNXXNLD85E0QT 1 64 0 1 /.well-known/acme-challenge/N9KV_XPE08MJ1KUSHCS0SDK4-SS25MZ1 1 64 1 0 END_SIDER