AWSTATS DATA FILE 7.8 (build 20200416) # If you remove this file, all statistics for date 202406 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/awstats.adhyapakmahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2037 POS_TIME 2698 POS_VISITOR 6488 POS_DAY 6820 POS_DOMAIN 3274 POS_LOGIN 3533 POS_ROBOT 3688 POS_WORMS 3908 POS_EMAILSENDER 4039 POS_EMAILRECEIVER 4182 POS_SESSION 6919 POS_SIDER 7065 POS_FILETYPES 4317 POS_DOWNLOADS 4418 POS_OS 4466 POS_BROWSER 4555 POS_SCREENSIZE 4647 POS_UNKNOWNREFERER 4721 POS_UNKNOWNREFERERBROWSER 4949 POS_ORIGIN 5069 POS_SEREFERRALS 5201 POS_PAGEREFS 5345 POS_SEARCHWORDS 5493 POS_KEYWORDS 5645 POS_MISC 2362 POS_ERRORS 5704 POS_CLUSTER 3389 POS_SIDER_404 5835 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20240701062319 3 268 16273619114630 FirstTime 0 LastTime 20240627001101 LastUpdate 20240701183018 3 0 2 0 0 TotalVisits 7 TotalUnique 7 MonthHostsKnown 0 MonthHostsUnknown 7 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 QuickTimeSupport 0 0 0 RealPlayerSupport 0 0 0 AddToFavourites 0 0 0 PDFSupport 0 0 0 FlashSupport 0 0 0 WindowsMediaPlayerSupport 0 0 0 TotalMisc 0 0 0 JavaEnabled 0 0 0 DirectorSupport 0 0 0 JavascriptDisabled 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 3 3 37813 70 70 853127 1 0 0 0 4 4 904 2 0 0 0 66 66 816104 3 14 14 1126 45 45 395861 4 0 0 0 4 4 0 5 0 0 0 6 6 0 6 0 0 0 4 4 0 7 0 0 0 8 8 0 8 0 0 0 37 37 408052 9 0 0 0 33 33 408052 10 0 0 0 4 4 0 11 0 0 0 2 2 0 12 0 0 0 6 6 0 13 0 0 0 2 2 0 14 0 0 0 35 37 393664 15 0 0 0 68 68 816104 16 0 0 0 0 0 0 17 0 0 0 37 37 408052 18 0 0 0 37 37 408052 19 0 0 0 37 37 408052 20 0 0 0 2 2 0 21 0 0 0 4 4 37000 22 0 0 0 33 33 362862 23 0 0 0 33 33 408052 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 4 us 10 10 778 ru 3 3 37813 gb 2 2 174 zz 2 2 174 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 2 Go\-http\-client/ 60 18690 20240630095037 0 bot[\s_+:,\.\;\/\\-] 2 220 20240614144013 2 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 2 html 3 37813 0 0 Unknown 14 1126 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 0 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 2 Unknown 14 14 linux 3 3 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 3 firefox95.0 3 3 Unknown 4 4 mozilla 10 10 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 2 Mozilla/5.0_(compatible;_Let's_Encrypt_validation_server;__https://www.letsencrypt.org) 20240617035120 Cpanel-HTTP-Client/1.0 20240617035107 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 1 Cpanel-HTTP-Client/1.0 20240617035107 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 17 17 From1 0 0 From2 0 0 From3 0 0 From4 0 0 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 5 409 1 83 406 19 4294 404 334 6100651 301 162 0 302 1 0 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 15 /v2/_catalog 30 - /ecp/Current/exporttool/microsoft.exchange.ediscovery.exporttool.application 30 - /login.action 30 - /telescope/requests 30 - /s/730323e2834323e20313e2631323/_/ 30 - /config.json 15 - /wordpress/ 2 - /.vscode/sftp.json 15 - /// 1 - /.DS_Store 30 - /_all_dbs 30 - /server 30 - / 1 - /.git/config 30 - /debug/default/view 30 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 7 216.10.248.154 4 4 256 20240617035107 185.243.3.154 3 3 37813 20240627001101 23.178.112.101 2 2 174 20240617035117 3.16.22.249 2 2 174 20240617035120 35.92.251.73 2 2 174 20240617035120 18.136.105.210 2 2 174 20240617035119 51.20.79.227 2 2 174 20240617035120 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 2 20240617 14 14 1126 6 20240627 3 3 37813 1 END_DAY # Session range - Number of visits BEGIN_SESSION 1 0s-30s 7 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 6 /.well-known/acme-challenge/kgSiZJmcyE3DL3tixDOml6JnIO7OqKWsQwZbesXE-0I 10 870 5 5 /.well-known/acme-challenge/M259_H216M394FVF7DFJ0TIG5282G3QG 2 128 1 0 /.well-known/acme-challenge/NLR24_E_RVN7335ON4_RZGUQ80IAUB8U 2 128 0 1 // 1 18774 0 0 / 1 18774 1 0 //wp-json/wp/v2/users/ 1 265 0 1 END_SIDER