AWSTATS DATA FILE 7.8 (build 20200416) # If you remove this file, all statistics for date 202406 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/awstats.testsahyadrimahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2041 POS_TIME 2700 POS_VISITOR 6507 POS_DAY 6802 POS_DOMAIN 3314 POS_LOGIN 3560 POS_ROBOT 3715 POS_WORMS 3936 POS_EMAILSENDER 4067 POS_EMAILRECEIVER 4210 POS_SESSION 6880 POS_SIDER 7026 POS_FILETYPES 4345 POS_DOWNLOADS 4429 POS_OS 4477 POS_BROWSER 4556 POS_SCREENSIZE 4632 POS_UNKNOWNREFERER 4706 POS_UNKNOWNREFERERBROWSER 4934 POS_ORIGIN 5054 POS_SEREFERRALS 5186 POS_PAGEREFS 5330 POS_SEARCHWORDS 5478 POS_KEYWORDS 5630 POS_MISC 2364 POS_ERRORS 5689 POS_CLUSTER 3416 POS_SIDER_404 5816 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20240701231342 1 0 14821861935464 FirstTime 0 LastTime 20240608034716 LastUpdate 20240702183230 1 0 0 0 0 TotalVisits 6 TotalUnique 6 MonthHostsKnown 0 MonthHostsUnknown 6 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 QuickTimeSupport 0 0 0 RealPlayerSupport 0 0 0 DirectorSupport 0 0 0 JavaEnabled 0 0 0 FlashSupport 0 0 0 JavascriptDisabled 0 0 0 PDFSupport 0 0 0 AddToFavourites 0 0 0 WindowsMediaPlayerSupport 0 0 0 TotalMisc 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 0 0 0 2 2 0 1 0 0 0 69 69 1833224 2 0 0 0 5 5 83 3 14 14 1126 51 51 1168504 4 0 0 0 3 3 83 5 0 0 0 74 74 1831868 6 0 0 0 3 3 83 7 0 0 0 33 33 886511 8 0 0 0 5 5 83 9 0 0 0 33 33 878766 10 0 0 0 43 43 1001452 11 0 0 0 105 105 2630236 12 0 0 0 50 50 996212 13 0 0 0 33 35 752335 14 0 0 0 44 44 903981 15 0 0 0 33 33 920596 16 0 0 0 45 45 920266 17 0 0 0 4 4 0 18 0 0 0 8 8 0 19 0 0 0 72 72 1904176 20 0 0 0 33 33 852923 21 0 0 0 104 104 2680968 22 0 0 0 105 105 2743064 23 0 0 0 8 8 166 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 3 us 10 10 778 ca 2 2 174 zz 2 2 174 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 2 Go\-http\-client/ 100 32600 20240630190110 0 bot[\s_+:,\.\;\/\\-] 2 246 20240613135612 2 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 1 Unknown 14 1126 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 0 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 1 Unknown 14 14 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 2 Unknown 4 4 mozilla 10 10 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 2 Cpanel-HTTP-Client/1.0 20240608034707 Mozilla/5.0_(compatible;_Let's_Encrypt_validation_server;__https://www.letsencrypt.org) 20240608034716 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 1 Cpanel-HTTP-Client/1.0 20240608034707 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 14 14 From1 0 0 From2 0 0 From3 0 0 From4 0 0 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 4 404 562 22865779 409 13 1079 301 264 0 406 26 5876 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 15 /v2/_catalog 50 - /_all_dbs 50 - /ecp/Current/exporttool/microsoft.exchange.ediscovery.exporttool.application 50 - /server 50 - /index_sso.php 2 - /wordpress/ 2 - /php/thinkphp/aaaffff123.php 2 - /.vscode/sftp.json 25 - /.DS_Store 50 - /s/730323e2834323e20313e2631323/_/ 50 - /config.json 25 - /debug/default/view 50 - /login.action 50 - /telescope/requests 50 - /.git/config 56 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 6 216.10.248.154 4 4 256 20240608034707 18.237.223.61 2 2 174 20240608034716 23.178.112.205 2 2 174 20240608034716 18.118.144.7 2 2 174 20240608034716 47.129.39.144 2 2 174 20240608034715 16.16.216.173 2 2 174 20240608034716 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 1 20240608 14 14 1126 6 END_DAY # Session range - Number of visits BEGIN_SESSION 1 0s-30s 6 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 3 /.well-known/acme-challenge/T35zvbqxOEJGvqDCucIFhaBqN5Ss9ucQ7VPRXLfJ_Uo 10 870 5 5 /.well-known/acme-challenge/Z_VYIV88WW8ZI31YJ_0XB9GI7ZZZKZF1 2 128 0 1 /.well-known/acme-challenge/0Q7MJ1ANIXIAO_7IP13E-ZEMGW8MXXZI 2 128 1 0 END_SIDER