AWSTATS DATA FILE 7.9 (build 20230108) # If you remove this file, all statistics for date 202506 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/awstats.testsahyadrimahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2075 POS_TIME 2740 POS_VISITOR 6209 POS_DAY 6540 POS_DOMAIN 3313 POS_LOGIN 3562 POS_ROBOT 3717 POS_WORMS 3849 POS_EMAILSENDER 3980 POS_EMAILRECEIVER 4123 POS_SESSION 6640 POS_FILESIZE 7096 POS_SIDER 6786 POS_FILETYPES 4258 POS_DOWNLOADS 4359 POS_OS 4407 POS_BROWSER 4496 POS_SCREENSIZE 4596 POS_UNKNOWNREFERER 4670 POS_UNKNOWNREFERERBROWSER 4898 POS_ORIGIN 5018 POS_SEREFERRALS 5150 POS_PAGEREFS 5294 POS_SEARCHWORDS 5442 POS_KEYWORDS 5594 POS_MISC 2404 POS_ERRORS 5653 POS_CLUSTER 3418 POS_SIDER_404 5778 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20250612233626 20 4824 16992623757547 FirstTime 0 LastTime 20250612072349 LastUpdate 20250613133226 20 0 20 0 0 TotalVisits 7 TotalUnique 7 MonthHostsKnown 0 MonthHostsUnknown 7 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 JavascriptDisabled 0 0 0 DirectorSupport 0 0 0 TotalMisc 0 0 0 WindowsMediaPlayerSupport 0 0 0 JavaEnabled 0 0 0 RealPlayerSupport 0 0 0 PDFSupport 0 0 0 QuickTimeSupport 0 0 0 FlashSupport 0 0 0 AddToFavourites 0 2 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 0 0 0 4 4 0 1 0 0 0 8 8 332 2 0 0 0 8 8 498 3 14 14 1126 17 17 415 4 0 0 0 7 7 581 5 0 0 0 5 5 415 6 0 0 0 11 11 867 7 2 2 119376 26 26 327627 8 0 0 0 16 16 82460 9 0 0 0 10 10 830 10 0 0 0 11 11 581 11 0 0 0 16 16 830 12 0 0 0 13 13 890 13 0 0 0 13 13 82643 14 0 0 0 13 15 82643 15 0 0 0 10 10 332 16 0 0 0 12 12 830 17 0 0 0 19 19 415 18 0 0 0 6 6 309 19 0 0 0 22 24 166 20 0 0 0 4 4 618 21 0 0 0 8 8 166 22 0 0 0 19 19 415 23 0 0 0 11 11 83 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 3 us 12 12 952 gb 2 2 119376 zz 2 2 174 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 0 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 2 Unknown 14 1126 0 0 php 2 119376 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 0 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 2 win10 2 2 Unknown 14 14 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 3 Unknown 4 4 mozilla 10 10 chrome58.0.3029.110 2 2 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 2 Mozilla/5.0_(compatible;_Let's_Encrypt_validation_server;__https://www.letsencrypt.org) 20250609033712 Cpanel-HTTP-Client/1.0 20250609033705 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 1 Cpanel-HTTP-Client/1.0 20250609033705 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 16 16 From1 0 0 From2 0 0 From3 0 0 From4 0 0 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 4 301 136 0 406 7 1582 404 14 572242 409 134 11122 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 7 /phpinfo.php 2 - /wordpress/ 2 - /.aws/credentials 2 - /_profiler/phpinfo 2 - /test.php 2 - /.git/config 2 - /ads.txt 2 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 7 216.10.248.154 4 4 256 20250609033705 5.62.57.38 2 2 119376 20250612072350 18.142.144.126 2 2 174 20250609033711 18.217.200.64 2 2 174 20250609033712 13.61.9.74 2 2 174 20250609033712 23.178.112.108 2 2 174 20250609033711 35.91.165.159 2 2 174 20250609033712 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 2 20250609 14 14 1126 6 20250612 2 2 119376 1 END_DAY # Session range - Number of visits BEGIN_SESSION 1 0s-30s 7 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 4 /.well-known/acme-challenge/4KLaT1P_vaG9OvYLvcbGYIM5fLAQjNzamcxR9cayMdU 10 870 5 5 /.well-known/acme-challenge/SI5UYGJN8-4VSHWMU_NYTY6S00B0E0HL 2 128 1 0 /.well-known/acme-challenge/L1Y3_ENKZ56HBO5RJRS_N2276-7AWFTT 2 128 0 1 /index.php 2 119376 1 1 END_SIDER # Payload Range - Payload Frequency BEGIN_FILESIZE 4 44-100 148 0-44 138 100-500 7 5K+ 16 END_FILESIZE