AWSTATS DATA FILE 7.8 (build 20200416) # If you remove this file, all statistics for date 202307 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/awstats.testsahyadrimahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2041 POS_TIME 2713 POS_VISITOR 6249 POS_DAY 6583 POS_DOMAIN 3217 POS_LOGIN 3458 POS_ROBOT 3613 POS_WORMS 3776 POS_EMAILSENDER 3907 POS_EMAILRECEIVER 4050 POS_SESSION 6764 POS_SIDER 6911 POS_FILETYPES 4185 POS_DOWNLOADS 4313 POS_OS 4361 POS_BROWSER 4461 POS_SCREENSIZE 4580 POS_UNKNOWNREFERER 4654 POS_UNKNOWNREFERERBROWSER 5012 POS_ORIGIN 5178 POS_SEREFERRALS 5311 POS_PAGEREFS 5455 POS_SEARCHWORDS 5603 POS_KEYWORDS 5755 POS_MISC 2377 POS_ERRORS 5814 POS_CLUSTER 3314 POS_SIDER_404 5910 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20230802113924 1 0 13179540359077 FirstTime 20230702175321 LastTime 20230728165556 LastUpdate 20230802180944 1 0 0 0 0 TotalVisits 10 TotalUnique 6 MonthHostsKnown 0 MonthHostsUnknown 7 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 DirectorSupport 0 0 0 FlashSupport 0 0 0 JavascriptDisabled 0 0 0 RealPlayerSupport 0 0 0 QuickTimeSupport 0 0 0 WindowsMediaPlayerSupport 0 0 0 AddToFavourites 0 6 0 TotalMisc 0 0 0 PDFSupport 0 0 0 JavaEnabled 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 0 0 0 0 0 0 1 0 0 0 0 0 0 2 0 0 0 0 0 0 3 0 0 0 0 0 0 4 0 0 0 0 0 0 5 0 0 0 0 0 0 6 3 23 1030205 0 6 33116 7 0 0 0 0 0 0 8 2 2 18264 0 0 0 9 0 0 0 0 0 0 10 0 0 0 0 0 0 11 3 4 22383 0 2 0 12 4 5 22383 2 4 0 13 0 0 0 0 0 0 14 0 0 0 0 0 0 15 0 0 0 0 0 0 16 1 1 0 2 2 0 17 3 4 22383 0 2 0 18 0 0 0 0 0 0 19 0 0 0 0 0 0 20 0 0 0 0 0 0 21 0 0 0 0 0 0 22 0 0 0 0 0 0 23 0 0 0 0 0 0 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 2 us 14 36 1093235 be 2 3 22383 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 1 unknown 2 260 20230703065126 2 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 4 png 3 12357 0 0 php 6 0 0 0 js 20 1011941 0 0 html 10 91320 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 0 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 3 linux 2 2 win10 22 2 Unknown 15 12 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 4 chrome84.0.4147.105 22 2 chrome108.0.0.0 2 2 mozilla 9 6 Unknown 6 6 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 3 WordPress/6.2.2;_https://testsahyadrimahavidyalay.ptechinstitute.com 20230728165556 Mozilla/5.0_(compatible;_CensysInspect/1.1;__https://about.censys.io/) 20230705113640 Mozilla/5.0_(compatible;_InternetMeasurement/1.0;__https://internet-measurement.com/) 20230711123411 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 1 WordPress/6.2.2;_https://testsahyadrimahavidyalay.ptechinstitute.com 20230728165556 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 14 22 From1 0 0 From2 0 0 From3 0 0 From4 2 17 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 2 301 4 0 404 4 32856 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 2 /ads.txt 2 - /app-ads.txt 2 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 7 216.10.248.154 6 6 0 20230728165556 87.236.176.237 2 2 18264 20230711123352 162.142.125.215 2 3 22383 20230705113637 35.212.26.22 2 22 1030205 20230703065126 164.92.174.142 2 2 18264 20230712084930 167.94.138.35 2 3 22383 20230702175321 87.236.176.248 0 1 4119 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 6 20230702 3 4 22383 2 20230703 3 23 1030205 2 20230705 3 4 22383 2 20230711 4 5 22383 2 20230712 2 2 18264 1 20230728 1 1 0 1 END_DAY # Session range - Number of visits BEGIN_SESSION 1 0s-30s 10 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 2 / 10 91320 5 5 /wp-cron.php 6 0 5 5 END_SIDER