AWSTATS DATA FILE 7.8 (build 20200416) # If you remove this file, all statistics for date 202407 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/awstats.testsahyadrimahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2041 POS_TIME 2699 POS_VISITOR 6309 POS_DAY 6418 POS_DOMAIN 3233 POS_LOGIN 3455 POS_ROBOT 3610 POS_WORMS 3829 POS_EMAILSENDER 3960 POS_EMAILRECEIVER 4103 POS_SESSION 6493 POS_SIDER 6639 POS_FILETYPES 4238 POS_DOWNLOADS 4316 POS_OS 4364 POS_BROWSER 4447 POS_SCREENSIZE 4521 POS_UNKNOWNREFERER 4595 POS_UNKNOWNREFERERBROWSER 4682 POS_ORIGIN 4764 POS_SEREFERRALS 4894 POS_PAGEREFS 5038 POS_SEARCHWORDS 5186 POS_KEYWORDS 5338 POS_MISC 2363 POS_ERRORS 5397 POS_CLUSTER 3311 POS_SIDER_404 5521 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20240801064625 1 0 7965700339280 FirstTime 0 LastTime 20240712185443 LastUpdate 20240801183614 1 0 0 0 0 TotalVisits 1 TotalUnique 1 MonthHostsKnown 0 MonthHostsUnknown 1 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 DirectorSupport 0 0 0 FlashSupport 0 0 0 RealPlayerSupport 0 0 0 JavascriptDisabled 0 0 0 JavaEnabled 0 0 0 TotalMisc 0 0 0 QuickTimeSupport 0 0 0 PDFSupport 0 0 0 AddToFavourites 0 4 0 WindowsMediaPlayerSupport 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 0 0 0 2 2 0 1 0 0 0 2 2 0 2 0 0 0 2 2 0 3 0 0 0 2 2 0 4 0 0 0 0 0 0 5 0 0 0 2 2 0 6 0 0 0 0 0 0 7 0 0 0 14 16 246 8 0 0 0 12 12 166 9 0 0 0 41 41 920266 10 0 0 0 4 4 0 11 0 0 0 5 5 83 12 0 0 0 2 2 0 13 0 0 0 8 8 0 14 0 0 0 43 45 920252 15 0 0 0 8 8 0 16 0 0 0 35 35 905420 17 0 0 0 39 39 870252 18 1 1 517 14 14 376926 19 0 0 0 4 4 0 20 0 0 0 2 2 0 21 0 0 0 2 2 166 22 0 0 0 12 12 417470 23 0 0 0 3 5 226 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 1 us 1 1 517 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 2 Go\-http\-client/ 16 5216 20240722144656 0 bot[\s_+:,\.\;\/\\-] 2 246 20240716070213 2 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 1 php 1 517 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 0 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 1 androidnougat 1 1 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 1 chrome60.0.3112.107 1 1 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 0 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 0 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 1 1 From1 0 0 From2 0 0 From3 0 0 From4 0 0 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 4 409 6 1615 406 5 1130 301 124 0 404 107 4403266 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 18 /docker-compose.yml 4 - /login.action 8 - /.DS_Store 8 - /OLD/wp-admin/setup-config.php 1 - /ecp/Current/exporttool/microsoft.exchange.ediscovery.exporttool.application 8 - /old/wp-admin/setup-config.php 1 - /s/730323e2834323e20313e2631323/_/ 8 - /v2/_catalog 8 - /debug/default/view 8 - /codebuild.yml 2 - /telescope/requests 8 - /_all_dbs 8 - /wordpress/wp-admin/setup-config.php 1 - /.git-credentials 2 - /config.json 4 - /server 8 - /.vscode/sftp.json 4 - /.git/config 16 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 1 159.223.46.93 1 1 517 20240712185443 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 1 20240712 1 1 517 1 END_DAY # Session range - Number of visits BEGIN_SESSION 1 0s-30s 1 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 1 /wp-admin/install.php 1 517 1 1 END_SIDER