AWSTATS DATA FILE 7.8 (build 20200416) # If you remove this file, all statistics for date 202308 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/awstats.testsahyadrimahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2041 POS_TIME 2714 POS_VISITOR 10047 POS_DAY 11792 POS_DOMAIN 3344 POS_LOGIN 3685 POS_ROBOT 3840 POS_WORMS 4168 POS_EMAILSENDER 4299 POS_EMAILRECEIVER 4442 POS_SESSION 12280 POS_SIDER 12468 POS_FILETYPES 4577 POS_DOWNLOADS 4730 POS_OS 4778 POS_BROWSER 4989 POS_SCREENSIZE 5426 POS_UNKNOWNREFERER 5500 POS_UNKNOWNREFERERBROWSER 6627 POS_ORIGIN 7396 POS_SEREFERRALS 7531 POS_PAGEREFS 7675 POS_SEARCHWORDS 7864 POS_KEYWORDS 8016 POS_MISC 2377 POS_ERRORS 8075 POS_CLUSTER 3541 POS_SIDER_404 8205 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20230904192017 1 0 14639195803831 FirstTime 20230802113924 LastTime 20230831201752 LastUpdate 20230905181250 1 0 0 0 0 TotalVisits 58 TotalUnique 42 MonthHostsKnown 0 MonthHostsUnknown 42 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 WindowsMediaPlayerSupport 0 0 0 PDFSupport 0 0 0 JavaEnabled 0 0 0 RealPlayerSupport 0 0 0 AddToFavourites 0 16 0 FlashSupport 0 0 0 TotalMisc 0 0 0 QuickTimeSupport 0 0 0 JavascriptDisabled 0 0 0 DirectorSupport 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 5 6 396705 0 2 0 1 5 5 640290 31 31 337558 2 0 0 0 2 2 328386 3 24 24 449218 51 51 770820 4 9 15 2416534 0 2 0 5 0 0 0 2 2 334460 6 2 2 71044 0 0 0 7 2 2 71044 0 0 0 8 4 4 376874 0 0 0 9 2 2 334460 0 0 0 10 6 12 2343972 3 5 494 11 12 19 3774989 2 16 146202 12 5 5 146776 4 43 3423380 13 3 3 74588 0 6 101416 14 5 6 149751 0 2 0 15 3 3 73388 3 3 226 16 3 3 70918 0 2 260 17 14 16 648960 0 4 0 18 11 13 365798 0 4 0 19 1 1 0 2 2 0 20 1 1 0 6 6 399000 21 0 0 0 0 0 0 22 0 0 0 0 0 0 23 5 12 3398101 2 2 0 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 9 us 92 118 11290522 ca 10 10 1339682 zz 4 4 348 cn 4 4 376852 gb 4 4 379218 de 2 2 71044 in 2 8 1968870 fr 2 2 305830 be 2 2 71044 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 5 PhantomJS 11 3398101 20230829122449 0 no_user_agent 10 1631522 20230828205417 0 Go\-http\-client/ 8 73036 20230816014327 0 unknown 4 520 20230819161400 4 archive\.org_bot 2 70614 20230820202205 0 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 5 Unknown 16 1300 0 0 php 20 0 0 0 jpg 24 10287088 0 0 png 8 32952 0 0 html 86 5482070 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 0 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 10 linux 34 20 linuxubuntu 2 2 Unknown 73 66 ios_iphone 2 2 androidmarshmallow 4 4 win7 4 4 macosx11 2 2 win8.1 2 2 androidlollipop 2 2 win10 29 18 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 19 chrome73.0.3683.90 2 2 firefox47.0 2 2 chrome108.0.0.0 12 12 chrome63.0.3239.132 2 2 chrome41.0.2225.0 2 2 chrome83.0.4103.61 2 2 firefox115.0 2 2 chrome106.0.0.0 2 2 chrome115.0.5790.170 22 8 chrome102.0.5005.63 2 2 chrome110.0.0.0 6 6 chrome79.0.3945.79 7 2 netscape5.0 2 2 safari15.1 2 2 chrome116.0.0.0 8 2 chrome84.0.4147.105 4 4 mozilla 35 28 chrome52.0.3624.98 4 4 Unknown 36 36 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 11 WordPress/6.3;_https://testsahyadrimahavidyalay.ptechinstitute.com 20230827181606 WordPress/6.2.2;_https://www.wpbeginner.com 20230829122447 Mozilla/5.0_researchscan.comsys.rwth-aachen.de 20230810185949 Mozilla/5.0_(compatible;_InternetMeasurement/1.0;__https://internet-measurement.com/) 20230809030325 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20230826004839 WordPress/6.3.1;_https://testsahyadrimahavidyalay.ptechinstitute.com 20230831201752 WordPress/6.2.2;_https://www.isitwp.com 20230829122435 Mozilla/5.0_(compatible;_CensysInspect/1.1;__https://about.censys.io/) 20230827181607 Cpanel-HTTP-Client/1.0 20230808033739 Mozilla/5.0_(compatible;_Let's_Encrypt_validation_server;__https://www.letsencrypt.org) 20230808033743 WordPress/6.2.2;_https://testsahyadrimahavidyalay.ptechinstitute.com 20230809032609 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 7 Cpanel-HTTP-Client/1.0 20230808033739 WordPress/6.3;_https://testsahyadrimahavidyalay.ptechinstitute.com 20230827181606 WordPress/6.2.2;_https://www.wpbeginner.com 20230829122447 WordPress/6.2.2;_https://testsahyadrimahavidyalay.ptechinstitute.com 20230809032609 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20230826004839 WordPress/6.3.1;_https://testsahyadrimahavidyalay.ptechinstitute.com 20230831201752 WordPress/6.2.2;_https://www.isitwp.com 20230829122435 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 114 114 From1 0 0 From2 0 0 From3 2 2 From4 6 38 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 1 https://md-in-74.webhostbox.net:2083 2 2 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 5 406 4 904 302 1 0 301 98 268 503 4 4312 404 27 662925 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 16 /app-ads.txt 2 - /https:/testsahyadrimahavidyalay.ptechinstitute.com/wp-content/plugins/elementor/assets/lib/eicons/css/elementor-icons.min.css 2 http://216.10.248.207:80/'https://testsahyadrimahavidyalay.ptechinstitute.com/wp-content/plugins/elementor/assets/lib/eicons/css/elementor-icons.min.css /wp/ 2 - /backup/ 2 - /old/ 2 - /wp-emoji-release.min.js 1 - /blog/ 2 - /https:/testsahyadrimahavidyalay.ptechinstitute.com/wp-content/themes/bizberg/assets/icons/font-awesome-5/css/all.css 1 http://216.10.248.207:80/'https://testsahyadrimahavidyalay.ptechinstitute.com/wp-content/themes/bizberg/assets/icons/font-awesome-5/css/all.css /test/ 2 - /https:/testsahyadrimahavidyalay.ptechinstitute.com/wp-content/plugins/elementor/assets/lib/font-awesome/css/regular.min.css 1 http://216.10.248.207:80/'https://testsahyadrimahavidyalay.ptechinstitute.com/wp-content/plugins/elementor/assets/lib/font-awesome/css/regular.min.css /new/ 2 - /ads.txt 2 - /https:/testsahyadrimahavidyalay.ptechinstitute.com/wp-content/plugins/elementor/assets/lib/font-awesome/css/solid.min.css 1 http://216.10.248.207:80/'https://testsahyadrimahavidyalay.ptechinstitute.com/wp-content/plugins/elementor/assets/lib/font-awesome/css/solid.min.css /wordpress/ 2 - /bk/ 2 - /https:/testsahyadrimahavidyalay.ptechinstitute.com/wp-content/plugins/elementor/assets/lib/font-awesome/css/fontawesome.min.css 1 http://216.10.248.207:80/'https://testsahyadrimahavidyalay.ptechinstitute.com/wp-content/plugins/elementor/assets/lib/font-awesome/css/fontawesome.min.css END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 42 216.10.248.154 24 24 256 20230831201752 65.154.226.167 6 13 3470669 20230829115007 183.136.225.44 4 4 376852 20230802114039 3.17.66.71 4 4 348 20230808033743 34.212.35.223 4 4 348 20230808033743 65.154.226.171 4 11 3398101 20230829234935 23.178.112.104 4 4 348 20230808033743 205.169.39.160 4 9 2034307 20230808041326 167.248.133.191 2 3 78707 20230813173008 142.93.50.86 2 2 74588 20230815145909 165.227.228.165 2 2 71044 20230811070411 164.90.222.93 2 2 305830 20230808033931 161.35.190.56 2 2 334460 20230816014322 104.164.195.15 2 2 305830 20230808170847 159.223.68.191 2 2 71044 20230809032606 205.210.31.79 2 2 305830 20230811012112 51.81.167.146 2 2 305830 20230808040813 134.209.195.146 2 2 71044 20230810181506 66.75.51.6 2 2 71044 20230808172745 38.132.193.74 2 2 71044 20230808172429 137.226.113.15 2 2 71044 20230810185949 128.199.0.178 2 2 73388 20230829152308 167.248.133.38 2 3 74471 20230812005912 167.248.133.35 2 3 78707 20230813172206 35.210.151.25 2 2 74588 20230815135456 165.22.229.73 2 2 71044 20230808183310 115.110.127.198 2 8 1968870 20230824100331 167.94.138.50 2 3 77525 20230827181603 167.99.1.18 2 2 71044 20230809082033 188.165.87.109 2 2 305830 20230810083414 35.188.13.186 2 2 73388 20230829122435 205.210.31.106 2 2 302570 20230822101926 205.210.31.165 2 2 334460 20230815094744 87.236.176.85 2 2 71044 20230809030325 34.70.129.202 2 2 73388 20230829122447 167.248.133.126 2 3 75141 20230805183456 162.142.125.217 2 3 76397 20230825040430 174.176.115.167 2 2 43628 20230808172849 205.210.31.87 2 2 322234 20230826004839 167.94.146.57 2 3 75163 20230809141619 34.70.187.119 2 2 71044 20230808061054 35.207.232.165 2 2 70918 20230819161400 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 20 20230802 7 7 376852 2 20230805 3 4 75141 2 20230808 37 42 3280901 13 20230809 10 11 288295 6 20230810 6 6 447918 3 20230811 4 4 376874 2 20230812 3 4 74471 2 20230813 6 8 157414 3 20230815 8 8 483636 4 20230816 3 3 334460 2 20230818 1 1 0 1 20230819 3 3 70918 2 20230822 2 2 302570 1 20230824 4 10 2041402 2 20230825 4 5 76397 3 20230826 2 2 322234 1 20230827 3 4 77525 2 20230829 14 28 7016402 5 20230830 1 1 0 1 20230831 1 1 0 1 END_DAY # Session range - Number of visits BEGIN_SESSION 5 5mn-15mn 1 2mn-5mn 1 30s-2mn 3 30mn-1h 1 0s-30s 52 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 6 / 86 5482070 39 39 /wp-cron.php 20 0 15 16 /.well-known/acme-challenge/81yi-ZDiqM1vueXFrcFO7tdFwt9btiOIglrGqMP9nFo 6 522 0 3 /.well-known/acme-challenge/WUYE_zzbZ6cGeXvBHvL_JPwgdq6AxNmWl5hZVsmW7RQ 6 522 3 0 /.well-known/acme-challenge/3WD2P0BSEO4_1PRPU6SEHAV__7S8451D 2 128 1 0 /.well-known/acme-challenge/ZOSZMN6O21ZJDGY_BWF5BRCY_K1OZAZB 2 128 0 0 END_SIDER