AWSTATS DATA FILE 7.8 (build 20200416) # If you remove this file, all statistics for date 202408 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/awstats.adhyapakmahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2037 POS_TIME 2695 POS_VISITOR 6082 POS_DAY 6416 POS_DOMAIN 3203 POS_LOGIN 3451 POS_ROBOT 3606 POS_WORMS 3782 POS_EMAILSENDER 3913 POS_EMAILRECEIVER 4056 POS_SESSION 6495 POS_SIDER 6641 POS_FILETYPES 4191 POS_DOWNLOADS 4292 POS_OS 4340 POS_BROWSER 4437 POS_SCREENSIZE 4525 POS_UNKNOWNREFERER 4599 POS_UNKNOWNREFERERBROWSER 4827 POS_ORIGIN 4947 POS_SEREFERRALS 5079 POS_PAGEREFS 5223 POS_SEARCHWORDS 5371 POS_KEYWORDS 5523 POS_MISC 2359 POS_ERRORS 5582 POS_CLUSTER 3307 POS_SIDER_404 5700 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20240901054926 1 0 8463910204054 FirstTime 0 LastTime 20240817063835 LastUpdate 20240901183453 1 0 0 0 0 TotalVisits 7 TotalUnique 7 MonthHostsKnown 0 MonthHostsUnknown 7 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 WindowsMediaPlayerSupport 0 0 0 JavaEnabled 0 0 0 RealPlayerSupport 0 0 0 FlashSupport 0 0 0 TotalMisc 0 0 0 DirectorSupport 0 0 0 JavascriptDisabled 0 0 0 QuickTimeSupport 0 0 0 PDFSupport 0 0 0 AddToFavourites 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 0 0 0 2 2 0 1 0 0 0 2 2 0 2 0 0 0 1 1 226 3 14 14 1126 14 14 0 4 0 0 0 2 2 0 5 0 0 0 16 16 0 6 1 1 26268 8 8 226 7 0 0 0 6 6 36940 8 0 0 0 4 4 36940 9 0 0 0 6 6 0 10 0 0 0 6 6 0 11 0 0 0 2 2 0 12 0 0 0 2 2 0 13 0 0 0 4 4 0 14 0 0 0 2 2 0 15 0 0 0 2 2 0 16 0 0 0 4 4 19670 17 0 0 0 2 2 0 18 0 0 0 0 0 0 19 0 0 0 2 2 0 20 0 0 0 0 0 0 21 0 0 0 2 2 0 22 0 0 0 0 0 0 23 0 0 0 2 4 220 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 3 us 12 12 952 zz 2 2 174 fr 1 1 26268 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 1 bot[\s_+:,\.\;\/\\-] 2 220 20240821234252 2 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 2 Unknown 14 1126 0 0 html 1 26268 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 0 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 2 androidkitkat 1 1 Unknown 14 14 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 3 mozilla 10 10 Unknown 4 4 android 1 1 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 2 Mozilla/5.0_(compatible;_Let's_Encrypt_validation_server;__https://www.letsencrypt.org) 20240817033511 Cpanel-HTTP-Client/1.0 20240817033504 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 1 Cpanel-HTTP-Client/1.0 20240817033504 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 15 15 From1 0 0 From2 0 0 From3 0 0 From4 0 0 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 4 409 1 1200 404 5 92350 406 2 452 301 83 0 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 3 /.git/HEAD 2 - /.git/config 2 - /wordpress/wp-admin/setup-config.php 1 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 7 216.10.248.154 4 4 256 20240817033504 23.178.112.211 2 2 174 20240817033510 13.251.129.42 2 2 174 20240817033510 3.145.172.119 2 2 174 20240817033511 35.93.0.45 2 2 174 20240817033511 16.16.194.145 2 2 174 20240817033511 176.144.241.157 1 1 26268 20240817063835 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 1 20240817 15 15 27394 7 END_DAY # Session range - Number of visits BEGIN_SESSION 1 0s-30s 7 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 4 /.well-known/acme-challenge/BSJ8PJxx18j20xcW6RwleT60jiY8-x2xo1XC4_yQOfg 10 870 5 5 /.well-known/acme-challenge/POJATHZGFLVC7DMZMBE4IP6BRX4FICL8 2 128 0 1 /.well-known/acme-challenge/ZT3ENM181U42-LVG7NWZOWJ6OE5_LT5B 2 128 1 0 / 1 26268 1 1 END_SIDER