AWSTATS DATA FILE 7.8 (build 20200416) # If you remove this file, all statistics for date 202408 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/awstats.testsahyadrimahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2041 POS_TIME 2699 POS_VISITOR 6471 POS_DAY 6803 POS_DOMAIN 3252 POS_LOGIN 3500 POS_ROBOT 3655 POS_WORMS 3874 POS_EMAILSENDER 4005 POS_EMAILRECEIVER 4148 POS_SESSION 6902 POS_SIDER 7048 POS_FILETYPES 4283 POS_DOWNLOADS 4384 POS_OS 4432 POS_BROWSER 4529 POS_SCREENSIZE 4617 POS_UNKNOWNREFERER 4691 POS_UNKNOWNREFERERBROWSER 4919 POS_ORIGIN 5039 POS_SEREFERRALS 5171 POS_PAGEREFS 5315 POS_SEARCHWORDS 5463 POS_KEYWORDS 5615 POS_MISC 2363 POS_ERRORS 5674 POS_CLUSTER 3356 POS_SIDER_404 5798 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20240901045908 1 0 8306703223464 FirstTime 0 LastTime 20240808033652 LastUpdate 20240901183440 1 0 0 0 0 TotalVisits 7 TotalUnique 7 MonthHostsKnown 0 MonthHostsUnknown 7 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 FlashSupport 0 0 0 JavascriptDisabled 0 0 0 AddToFavourites 0 4 0 PDFSupport 0 0 0 QuickTimeSupport 0 0 0 JavaEnabled 0 0 0 WindowsMediaPlayerSupport 0 0 0 DirectorSupport 0 0 0 RealPlayerSupport 0 0 0 TotalMisc 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 0 0 0 2 2 0 1 0 0 0 8 8 0 2 0 0 0 5 5 83720 3 14 14 1126 14 14 166 4 0 0 0 18 18 0 5 0 0 0 14 14 42947 6 0 0 0 49 51 967357 7 0 0 0 5 5 226 8 0 0 0 4 6 246 9 0 0 0 6 6 0 10 1 1 60649 9 9 83720 11 0 0 0 6 6 166 12 0 0 0 2 2 0 13 0 0 0 1 1 83 14 0 0 0 7 9 83 15 0 0 0 39 39 912305 16 0 0 0 6 6 0 17 0 0 0 33 33 885640 18 0 0 0 12 12 75673 19 0 0 0 41 41 886175 20 0 0 0 8 8 0 21 0 0 0 12 12 166 22 0 0 0 6 6 0 23 0 0 0 5 5 83 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 3 us 12 12 952 zz 2 2 174 ru 1 1 60649 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 2 Go\-http\-client/ 16 5216 20240820190428 0 bot[\s_+:,\.\;\/\\-] 2 246 20240821082756 2 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 2 Unknown 14 1126 0 0 html 1 60649 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 0 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 2 Unknown 14 14 androidkitkat 1 1 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 3 Unknown 4 4 android 1 1 mozilla 10 10 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 2 Mozilla/5.0_(compatible;_Let's_Encrypt_validation_server;__https://www.letsencrypt.org) 20240808033652 Cpanel-HTTP-Client/1.0 20240808033646 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 1 Cpanel-HTTP-Client/1.0 20240808033646 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 15 15 From1 0 0 From2 0 0 From3 0 0 From4 0 0 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 4 404 97 3929765 409 10 1947 406 7 1582 301 182 0 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 14 /.vscode/sftp.json 4 - /config.json 4 - /.DS_Store 8 - /ecp/Current/exporttool/microsoft.exchange.ediscovery.exporttool.application 8 - /debug/default/view 8 - /telescope/requests 8 - /s/730323e2834323e20313e2631323/_/ 8 - /wordpress/wp-admin/setup-config.php 1 - /login.action 8 - /v2/_catalog 8 - /_all_dbs 8 - /server 8 - /aspera/faspex/ 2 - /.git/config 14 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 7 216.10.248.154 4 4 256 20240808033646 23.178.112.100 2 2 174 20240808033651 13.49.227.1 2 2 174 20240808033652 18.219.102.179 2 2 174 20240808033652 3.1.210.161 2 2 174 20240808033652 54.202.243.56 2 2 174 20240808033652 85.192.41.110 1 1 60649 20240805105252 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 2 20240805 1 1 60649 1 20240808 14 14 1126 6 END_DAY # Session range - Number of visits BEGIN_SESSION 1 0s-30s 7 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 4 /.well-known/acme-challenge/buqU3YWI2f25NiOe5xdag6ETFhkzHGOgYkgfhK84AdE 10 870 5 5 /.well-known/acme-challenge/4EFLVK2Y5ZIDJQGO82Z8Z486LFOD4ZLG 2 128 1 0 /.well-known/acme-challenge/X8HCYTKOT8XKMSKLWVXRRVB782KXFXYX 2 128 0 1 / 1 60649 1 1 END_SIDER