AWSTATS DATA FILE 7.8 (build 20200416) # If you remove this file, all statistics for date 202309 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/awstats.testsahyadrimahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2041 POS_TIME 2700 POS_VISITOR 6928 POS_DAY 7435 POS_DOMAIN 3237 POS_LOGIN 3504 POS_ROBOT 3659 POS_WORMS 3862 POS_EMAILSENDER 3993 POS_EMAILRECEIVER 4136 POS_SESSION 7747 POS_SIDER 7894 POS_FILETYPES 4271 POS_DOWNLOADS 4383 POS_OS 4431 POS_BROWSER 4532 POS_SCREENSIZE 4649 POS_UNKNOWNREFERER 4723 POS_UNKNOWNREFERERBROWSER 5366 POS_ORIGIN 5817 POS_SEREFERRALS 5949 POS_PAGEREFS 6093 POS_SEARCHWORDS 6241 POS_KEYWORDS 6393 POS_MISC 2364 POS_ERRORS 6452 POS_CLUSTER 3360 POS_SIDER_404 6560 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20231002000908 1 0 11740801299951 FirstTime 0 LastTime 20230930053617 LastUpdate 20231002181129 1 0 0 0 0 TotalVisits 19 TotalUnique 11 MonthHostsKnown 0 MonthHostsUnknown 11 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 DirectorSupport 0 0 0 TotalMisc 0 0 0 RealPlayerSupport 0 0 0 JavaEnabled 0 0 0 AddToFavourites 0 6 0 JavascriptDisabled 0 0 0 QuickTimeSupport 0 0 0 PDFSupport 0 0 0 FlashSupport 0 0 0 WindowsMediaPlayerSupport 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 0 0 0 0 0 0 1 0 0 0 0 0 0 2 2 2 377734 0 0 0 3 0 0 0 0 0 0 4 0 0 0 0 0 0 5 3 4 88551 0 2 0 6 0 0 0 0 0 0 7 4 4 462152 0 0 0 8 0 0 0 0 0 0 9 3 4 87859 0 2 0 10 0 0 0 0 0 0 11 3 3 75958 2 8 111316 12 2 2 84426 0 0 0 13 3 3 83688 2 2 0 14 1 1 0 4 4 376500 15 0 0 0 0 0 0 16 0 0 0 2 2 0 17 0 0 0 0 0 0 18 3 3 84426 2 2 0 19 3 4 88537 1 3 226 20 1 1 0 0 32 27764 21 0 0 0 0 0 0 22 1 1 0 4 4 377734 23 0 0 0 0 0 0 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 4 us 21 24 517479 ca 4 4 755468 be 2 2 75958 nl 2 2 84426 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 2 no_user_agent 4 754234 20230925223129 0 unknown 2 260 20230926113552 2 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 3 html 20 1420974 0 0 png 3 12357 0 0 php 9 0 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 0 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 3 Unknown 24 21 linux 6 6 macosx6 2 2 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 4 Unknown 13 13 chrome104.0.0.0 2 2 chrome108.0.0.0 6 6 mozilla 11 8 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 4 WordPress/6.3.1;_https://testsahyadrimahavidyalay.ptechinstitute.com 20230930053617 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20230922025732 Mozilla/5.0_(compatible;_CensysInspect/1.1;__https://about.censys.io/) 20230930053618 Mozilla/5.0_(compatible;_InternetMeasurement/1.0;__https://internet-measurement.com/) 20230906114243 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 2 WordPress/6.3.1;_https://testsahyadrimahavidyalay.ptechinstitute.com 20230930053617 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20230922025732 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 29 29 From1 0 0 From2 0 0 From3 0 0 From4 0 3 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 3 301 43 0 404 5 138820 406 1 226 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 3 /ads.txt 2 - /wp-emoji-release.min.js 1 - /app-ads.txt 2 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 11 216.10.248.154 9 9 0 20230930053617 167.248.133.33 2 3 88537 20230925194602 165.22.220.214 2 2 84418 20230926074816 87.236.176.56 2 2 75958 20230906114243 143.110.249.208 2 2 83688 20230912131909 205.210.31.227 2 2 377734 20230920072435 167.248.133.125 2 3 87859 20230913091235 167.248.133.35 2 3 88551 20230930053613 205.210.31.98 2 2 377734 20230922025732 46.101.8.159 2 2 84426 20230922181740 54.226.93.89 2 2 84426 20230922122230 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 13 20230906 2 2 75958 1 20230908 1 1 0 1 20230912 2 2 83688 1 20230913 3 4 87859 2 20230914 1 1 0 1 20230915 1 1 0 1 20230919 1 1 0 1 20230920 2 2 377734 1 20230922 6 6 546586 3 20230924 1 1 0 1 20230925 3 4 88537 2 20230926 3 3 84418 2 20230930 3 4 88551 2 END_DAY # Session range - Number of visits BEGIN_SESSION 1 0s-30s 19 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 2 / 20 1420974 10 10 /wp-cron.php 9 0 9 9 END_SIDER