AWSTATS DATA FILE 7.8 (build 20200416) # If you remove this file, all statistics for date 202409 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/awstats.adhyapakmahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2037 POS_TIME 2696 POS_VISITOR 6212 POS_DAY 7599 POS_DOMAIN 3227 POS_LOGIN 3483 POS_ROBOT 3638 POS_WORMS 3887 POS_EMAILSENDER 4018 POS_EMAILRECEIVER 4161 POS_SESSION 7726 POS_SIDER 7883 POS_FILETYPES 4296 POS_DOWNLOADS 4397 POS_OS 4445 POS_BROWSER 4524 POS_SCREENSIZE 4602 POS_UNKNOWNREFERER 4676 POS_UNKNOWNREFERERBROWSER 4763 POS_ORIGIN 4845 POS_SEREFERRALS 4979 POS_PAGEREFS 5123 POS_SEARCHWORDS 5271 POS_KEYWORDS 5423 POS_MISC 2360 POS_ERRORS 5482 POS_CLUSTER 3339 POS_SIDER_404 5601 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20241001091109 1 0 14727067258202 FirstTime 0 LastTime 20240923015701 LastUpdate 20241001182000 1 0 0 0 0 TotalVisits 35 TotalUnique 35 MonthHostsKnown 0 MonthHostsUnknown 35 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 WindowsMediaPlayerSupport 0 0 0 DirectorSupport 0 0 0 AddToFavourites 0 0 0 TotalMisc 0 0 0 RealPlayerSupport 0 0 0 JavaEnabled 0 0 0 QuickTimeSupport 0 0 0 FlashSupport 0 0 0 JavascriptDisabled 0 0 0 PDFSupport 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 0 0 0 0 0 0 1 42 42 178225 2 2 309 2 0 0 0 4 4 0 3 14 14 166997 7 7 226 4 0 0 0 0 0 0 5 0 0 0 41 41 345177 6 0 0 0 8 8 0 7 53 53 21450 9 9 226 8 0 0 0 4 4 0 9 0 0 0 2 4 220 10 0 0 0 8 8 0 11 0 0 0 0 0 0 12 0 0 0 0 0 0 13 0 0 0 4 4 0 14 0 0 0 2 2 0 15 0 0 0 0 0 0 16 0 0 0 2 2 0 17 3 3 162584 2 2 166 18 0 0 0 4 4 0 19 0 0 0 4 4 0 20 3 3 162584 1 1 83 21 0 0 0 4 4 0 22 0 0 0 2 2 36940 23 0 0 0 2 4 220 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 3 de 53 53 21450 us 47 47 664375 in 15 15 6015 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 3 Go\-http\-client/ 4 1246 20240908053041 0 unknown 2 220 20240926092501 2 bot[\s_+:,\.\;\/\\-] 2 220 20240912232406 2 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 2 php 102 40908 0 0 html 13 650932 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 0 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 1 win10 115 115 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 1 chrome63.0.3239.132 115 115 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 0 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 0 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 115 115 From1 0 0 From2 0 0 From3 0 0 From4 0 0 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 4 406 4 904 301 76 0 409 4 332 404 24 380645 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 12 /v2/_catalog 2 - /login.action 2 - /server 2 - /_all_dbs 2 - /ecp/Current/exporttool/microsoft.exchange.ediscovery.exporttool.application 2 - /config.json 1 - /.DS_Store 2 - /s/730323e2834323e20313e2631323/_/ 2 - /.git/config 4 - /telescope/requests 2 - /debug/default/view 2 - /.vscode/sftp.json 1 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 35 76.164.207.216 14 14 166997 20240922035840 93.127.170.15 11 11 4411 20240922075222 93.127.170.17 11 11 4411 20240922075223 93.127.170.18 11 11 4411 20240922075223 93.127.170.14 10 10 4010 20240922075222 93.127.170.16 10 10 4207 20240922075223 172.98.32.28 4 4 162987 20240923015556 136.144.42.48 3 3 162584 20240919173455 216.24.210.169 3 3 162584 20240922201355 45.132.227.32 3 3 1203 20240923015652 45.132.227.31 3 3 1203 20240923015653 172.98.32.45 3 3 1203 20240923015647 136.144.42.52 2 2 802 20240923015646 45.132.227.22 2 2 802 20240923015637 172.98.32.37 2 2 802 20240923015656 45.132.227.29 2 2 802 20240923015635 172.98.32.31 2 2 802 20240923015650 172.98.32.48 2 2 802 20240923015642 172.98.32.47 1 1 401 20240923015654 136.144.42.44 1 1 401 20240923015628 45.132.227.19 1 1 401 20240923015601 172.98.32.39 1 1 401 20240923015618 172.98.32.36 1 1 401 20240923015624 45.132.227.20 1 1 401 20240923015602 172.98.32.46 1 1 401 20240923015626 172.98.32.41 1 1 401 20240923015608 45.132.227.24 1 1 401 20240923015659 172.98.32.40 1 1 401 20240923015657 45.132.227.27 1 1 401 20240923015701 172.98.32.35 1 1 401 20240923015631 172.98.32.30 1 1 401 20240923015634 172.98.32.29 1 1 401 20240923015610 172.98.32.44 1 1 401 20240923015612 136.144.42.51 1 1 401 20240923015615 45.132.227.23 1 1 401 20240923015648 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 3 20240919 3 3 162584 1 20240922 70 70 351031 7 20240923 42 42 178225 27 END_DAY # Session range - Number of visits BEGIN_SESSION 2 30s-2mn 2 0s-30s 33 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 3 /xmlrpc.php 102 40908 30 33 / 8 647952 4 0 /wp-json/wp/v2/users/ 5 2980 1 2 END_SIDER