AWSTATS DATA FILE 7.8 (build 20200416) # If you remove this file, all statistics for date 202310 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/awstats.testsahyadrimahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2041 POS_TIME 2701 POS_VISITOR 7460 POS_DAY 8614 POS_DOMAIN 3294 POS_LOGIN 3577 POS_ROBOT 3732 POS_WORMS 3937 POS_EMAILSENDER 4068 POS_EMAILRECEIVER 4211 POS_SESSION 9092 POS_SIDER 9249 POS_FILETYPES 4346 POS_DOWNLOADS 4499 POS_OS 4547 POS_BROWSER 4658 POS_SCREENSIZE 4853 POS_UNKNOWNREFERER 4927 POS_UNKNOWNREFERERBROWSER 5795 POS_ORIGIN 6368 POS_SEREFERRALS 6501 POS_PAGEREFS 6645 POS_SEARCHWORDS 6793 POS_KEYWORDS 6945 POS_MISC 2364 POS_ERRORS 7004 POS_CLUSTER 3433 POS_SIDER_404 7122 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20231102091018 1 0 23444019623127 FirstTime 0 LastTime 20231031235958 LastUpdate 20231102181748 1 0 0 0 0 TotalVisits 40 TotalUnique 27 MonthHostsKnown 0 MonthHostsUnknown 27 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 PDFSupport 0 0 0 WindowsMediaPlayerSupport 0 0 0 DirectorSupport 0 0 0 AddToFavourites 0 10 0 FlashSupport 0 0 0 RealPlayerSupport 0 0 0 JavascriptDisabled 0 0 0 JavaEnabled 0 0 0 TotalMisc 0 0 0 QuickTimeSupport 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 2 2 377728 3 3 392 1 3 4 88565 0 2 0 2 4 5 88557 2 4 0 3 30 48 9317485 1 1 83 4 0 0 0 4 72 405685 5 3 4 88557 1 3 83 6 2 2 377728 2 2 377728 7 4 4 462178 0 0 0 8 3 3 377732 2 2 0 9 4 4 462186 0 0 0 10 0 0 0 0 0 0 11 9 15 3148353 2 10 377748 12 6 6 462166 2 2 0 13 0 0 0 2 2 377732 14 2 2 377748 2 2 377728 15 0 0 0 0 0 0 16 0 0 0 0 0 0 17 1 1 0 0 32 27774 18 3 3 84442 11 13 260 19 7 8 550751 0 2 0 20 0 0 0 0 0 0 21 1 1 0 2 2 0 22 0 0 0 0 0 0 23 3 4 88539 1 3 83 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 5 us 61 90 12783841 ca 18 18 3399656 zz 4 4 348 be 2 2 84432 au 2 2 84438 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 2 no_user_agent 10 1888682 20231030131952 0 unknown 2 260 20231023183234 2 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 5 php 13 0 0 0 html 58 5088416 0 0 jpg 24 11242404 0 0 png 5 20595 0 0 Unknown 16 1300 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 0 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 4 Unknown 64 59 win10 12 6 linux 36 18 win7 4 4 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 7 Unknown 35 35 chrome83.0.4103.61 4 4 chrome79.0.3945.79 10 4 mozilla 29 24 chrome108.0.0.0 6 6 chrome84.0.4147.105 2 2 chrome117.0.5938.88 30 12 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 7 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20231031082636 WordPress/6.3.1;_https://testsahyadrimahavidyalay.ptechinstitute.com 20231011215110 WordPress/6.3.2;_https://testsahyadrimahavidyalay.ptechinstitute.com 20231031235958 Mozilla/5.0_(compatible;_InternetMeasurement/1.0;__https://internet-measurement.com/) 20231003070010 Mozilla/5.0_(compatible;_CensysInspect/1.1;__https://about.censys.io/) 20231031235958 Mozilla/5.0_(compatible;_Let's_Encrypt_validation_server;__https://www.letsencrypt.org) 20231008033350 Cpanel-HTTP-Client/1.0 20231008033346 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 4 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20231031082636 WordPress/6.3.1;_https://testsahyadrimahavidyalay.ptechinstitute.com 20231011215110 Cpanel-HTTP-Client/1.0 20231008033346 WordPress/6.3.2;_https://testsahyadrimahavidyalay.ptechinstitute.com 20231031235958 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 81 81 From1 0 0 From2 0 0 From3 0 0 From4 6 35 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 4 409 7 581 406 1 226 301 125 0 404 2 55547 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 1 /wp-emoji-release.min.js 2 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 27 216.10.248.154 17 17 256 20231031235958 65.154.226.166 12 30 8938439 20231029035534 205.169.39.246 4 4 168876 20231008110309 205.169.39.149 4 10 2979477 20231008110257 18.117.73.182 4 4 348 20231008033350 35.92.186.35 4 4 348 20231008033350 35.217.6.152 2 2 84442 20231023183233 23.178.112.209 2 2 174 20231008033350 205.210.31.84 2 2 377728 20231017125646 167.248.133.190 2 3 88565 20231022015131 23.178.112.208 2 2 174 20231008033350 87.236.176.105 2 2 84432 20231003070010 198.235.24.11 2 2 377746 20231026031539 198.235.24.239 2 2 377748 20231003092649 205.210.31.66 2 2 377746 20231021074331 198.235.24.169 2 2 377728 20231014061526 198.235.24.46 2 2 377748 20231006143159 167.248.133.123 2 3 88557 20231006021719 159.203.168.113 2 2 84438 20231010125808 167.248.133.185 2 3 88557 20231004195023 205.210.31.46 2 2 377732 20231031082636 198.235.24.162 2 2 377752 20231027195317 205.210.31.253 2 2 377728 20231015001332 159.223.207.12 2 2 84442 20231024192358 167.248.133.126 2 3 88557 20231008053433 199.45.155.16 2 3 88539 20231031235954 139.59.56.90 2 2 84438 20231006094704 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 20 20231003 4 4 462180 2 20231004 3 4 88557 2 20231006 7 8 550743 4 20231008 35 54 9197164 10 20231010 3 3 84438 2 20231011 1 1 0 1 20231014 2 2 377728 1 20231015 2 2 377728 1 20231017 2 2 377728 1 20231018 1 1 0 1 20231020 2 2 0 1 20231021 2 2 377746 1 20231022 3 4 88565 2 20231023 4 4 84442 3 20231024 2 2 84442 1 20231026 2 2 377746 1 20231027 2 2 377752 1 20231029 4 10 2979485 1 20231030 1 1 0 1 20231031 5 6 466271 3 END_DAY # Session range - Number of visits BEGIN_SESSION 2 30s-2mn 1 0s-30s 39 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 6 / 58 5088416 23 23 /wp-cron.php 13 0 12 12 /.well-known/acme-challenge/4DFEGBXrxQbGLNhCOT6PLv_KoH2gc-gJE31OhU3H2x0 6 522 1 3 /.well-known/acme-challenge/95UEpi0ycFdIPUDn5vtxRQh3X0wOqB7740U99l0jvk4 6 522 3 1 /.well-known/acme-challenge/NA3BZKRVCMFEF_C1Y7W928C4A7E6YTEN 2 128 1 0 /.well-known/acme-challenge/809P922SXHVLDDKG79_258_-FCS1JJP9 2 128 0 1 END_SIDER