AWSTATS DATA FILE 7.8 (build 20200416) # If you remove this file, all statistics for date 202410 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/awstats.adhyapakmahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2037 POS_TIME 2702 POS_VISITOR 6158 POS_DAY 7635 POS_DOMAIN 3244 POS_LOGIN 3512 POS_ROBOT 3667 POS_WORMS 3843 POS_EMAILSENDER 3974 POS_EMAILRECEIVER 4117 POS_SESSION 7782 POS_SIDER 7940 POS_FILETYPES 4252 POS_DOWNLOADS 4372 POS_OS 4420 POS_BROWSER 4511 POS_SCREENSIZE 4613 POS_UNKNOWNREFERER 4687 POS_UNKNOWNREFERERBROWSER 4915 POS_ORIGIN 5035 POS_SEREFERRALS 5167 POS_PAGEREFS 5311 POS_SEARCHWORDS 5459 POS_KEYWORDS 5611 POS_MISC 2366 POS_ERRORS 5670 POS_CLUSTER 3368 POS_SIDER_404 5790 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20241101065945 70 18063 8485537148560 FirstTime 0 LastTime 20241031221656 LastUpdate 20241101181929 70 0 69 0 0 TotalVisits 36 TotalUnique 36 MonthHostsKnown 0 MonthHostsUnknown 36 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 RealPlayerSupport 0 0 0 PDFSupport 0 0 0 JavaEnabled 0 0 0 JavascriptDisabled 0 0 0 WindowsMediaPlayerSupport 0 0 0 FlashSupport 0 0 0 QuickTimeSupport 0 0 0 TotalMisc 0 0 0 AddToFavourites 0 0 0 DirectorSupport 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 0 0 0 0 0 0 1 0 0 0 0 0 0 2 0 0 0 0 0 0 3 14 14 1126 8 8 0 4 0 0 0 6 6 36940 5 0 0 0 2 2 0 6 0 0 0 20 20 0 7 0 0 0 14 14 19670 8 0 0 0 4 4 0 9 0 0 0 2 4 220 10 0 0 0 8 8 73880 11 0 0 0 4 4 36940 12 0 0 0 4 4 36940 13 0 0 0 0 0 0 14 0 0 0 2 2 0 15 3 3 162584 4 4 452 16 0 0 0 2 2 0 17 3 3 162584 2 2 166 18 0 0 0 6 6 0 19 0 0 0 4 6 220 20 0 0 0 0 0 0 21 15 15 167398 3 3 226 22 52 52 182235 4 4 309 23 0 0 0 4 4 0 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 4 us 65 65 345597 ca 17 17 167572 nz 3 3 162584 zz 2 2 174 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 1 bot[\s_+:,\.\;\/\\-] 4 440 20241008194351 4 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 3 php 61 24465 0 0 Unknown 14 1126 0 0 html 12 650336 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 0 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 2 Unknown 14 14 win10 73 73 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 3 chrome63.0.3239.132 73 73 Unknown 4 4 mozilla 10 10 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 2 Cpanel-HTTP-Client/1.0 20241017034010 Mozilla/5.0_(compatible;_Let's_Encrypt_validation_server;__https://www.letsencrypt.org) 20241017034016 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 1 Cpanel-HTTP-Client/1.0 20241017034010 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 87 87 From1 0 0 From2 0 0 From3 0 0 From4 0 0 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 4 409 4 1449 406 4 904 404 11 203170 301 84 0 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 2 /wordpress/wp-admin/setup-config.php 1 - /.git/config 10 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 36 71.19.249.168 9 9 3806 20241031215138 71.19.249.219 6 6 163592 20241031215128 108.165.243.206 5 5 2005 20241031221642 108.165.243.209 4 4 162987 20241031221552 216.10.248.154 4 4 256 20241017034010 108.165.243.220 3 3 1203 20241031221641 108.165.243.208 3 3 1203 20241031221623 108.165.243.210 3 3 1203 20241031221633 45.86.202.120 3 3 162584 20241018174617 108.165.243.205 3 3 1203 20241031221644 45.67.97.52 3 3 162584 20241021155445 108.165.243.216 3 3 1203 20241031221638 108.165.243.200 3 3 1203 20241031221652 16.171.71.182 2 2 174 20241017034016 108.165.243.215 2 2 802 20241031221654 108.165.243.213 2 2 802 20241031221624 54.191.243.139 2 2 174 20241017034016 108.165.243.221 2 2 802 20241031221606 23.178.112.109 2 2 174 20241017034015 108.165.243.224 2 2 802 20241031221653 18.222.5.139 2 2 174 20241017034016 108.165.243.212 2 2 802 20241031221647 108.165.243.217 2 2 802 20241031221631 47.128.79.196 2 2 174 20241017034016 108.165.243.226 2 2 802 20241031221656 108.165.243.201 1 1 401 20241031221651 108.165.243.207 1 1 401 20241031221634 108.165.243.225 1 1 401 20241031221630 108.165.243.202 1 1 401 20241031221626 108.165.243.223 1 1 401 20241031221646 108.165.243.211 1 1 401 20241031221621 108.165.243.203 1 1 401 20241031221639 108.165.243.219 1 1 401 20241031221635 108.165.243.218 1 1 401 20241031221649 108.165.243.227 1 1 401 20241031221655 108.165.243.222 1 1 401 20241031221600 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 4 20241017 14 14 1126 6 20241018 3 3 162584 1 20241021 3 3 162584 1 20241031 67 67 349633 28 END_DAY # Session range - Number of visits BEGIN_SESSION 2 0s-30s 26 30s-2mn 10 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 6 /xmlrpc.php 61 24465 25 28 /.well-known/acme-challenge/77Z4tPnB-j6R0Cv_m3DYzUtn6juDmxkqu9tYjxP4XE0 10 870 5 5 / 8 647952 4 0 /wp-json/wp/v2/users/ 4 2384 1 2 /.well-known/acme-challenge/ZPIVIG0OS8P8D5R31WFYZTJFOTJUSECM 2 128 1 0 /.well-known/acme-challenge/LNB9XUXSE7ZS2K-PSIAL90T_VROFAQ3N 2 128 0 1 END_SIDER