AWSTATS DATA FILE 7.8 (build 20200416) # If you remove this file, all statistics for date 202410 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/awstats.testsahyadrimahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2041 POS_TIME 2700 POS_VISITOR 7731 POS_DAY 8106 POS_DOMAIN 3264 POS_LOGIN 3525 POS_ROBOT 3680 POS_WORMS 3856 POS_EMAILSENDER 3987 POS_EMAILRECEIVER 4130 POS_SESSION 8264 POS_SIDER 8410 POS_FILETYPES 4265 POS_DOWNLOADS 4380 POS_OS 4428 POS_BROWSER 4525 POS_SCREENSIZE 4625 POS_UNKNOWNREFERER 4699 POS_UNKNOWNREFERERBROWSER 4927 POS_ORIGIN 5047 POS_SEREFERRALS 5179 POS_PAGEREFS 5323 POS_SEARCHWORDS 5471 POS_KEYWORDS 5623 POS_MISC 2364 POS_ERRORS 5682 POS_CLUSTER 3381 POS_SIDER_404 5814 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20241101034217 1 0 13936738609998 FirstTime 0 LastTime 20241021032359 LastUpdate 20241101181924 1 0 0 0 0 TotalVisits 8 TotalUnique 8 MonthHostsKnown 0 MonthHostsUnknown 8 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 RealPlayerSupport 0 0 0 PDFSupport 0 0 0 AddToFavourites 0 0 0 FlashSupport 0 0 0 JavaEnabled 0 0 0 QuickTimeSupport 0 0 0 JavascriptDisabled 0 0 0 WindowsMediaPlayerSupport 0 0 0 TotalMisc 0 0 0 DirectorSupport 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 0 0 0 18 18 159468 1 0 0 0 4 4 166 2 0 0 0 11 11 226 3 15 15 1643 21 21 168654 4 0 0 0 4 4 0 5 0 0 0 4 6 246 6 0 0 0 10 10 83644 7 0 0 0 14 14 0 8 0 0 0 22 22 0 9 0 0 0 12 12 43022 10 0 0 0 6 6 0 11 0 0 0 4 4 0 12 0 0 0 8 8 0 13 0 0 0 2 2 83644 14 0 0 0 2 2 0 15 1 2 36140 7 9 126666 16 0 1 35623 2 4 125466 17 0 0 0 90 90 3468812 18 0 0 0 10 10 0 19 0 0 0 6 6 83644 20 0 0 0 2 2 0 21 0 0 0 61 61 2177960 22 0 0 0 6 6 0 23 0 0 0 4 4 0 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 4 us 12 12 952 zz 2 2 174 ca 1 2 36140 gb 1 2 36140 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 1 bot[\s_+:,\.\;\/\\-] 2 246 20241008050300 2 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 3 css 2 71246 0 0 Unknown 14 1126 0 0 php 2 1034 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 0 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 2 Unknown 14 14 androidnougat 4 2 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 3 chrome60.0.3112.107 4 2 mozilla 10 10 Unknown 4 4 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 2 Cpanel-HTTP-Client/1.0 20241008033937 Mozilla/5.0_(compatible;_Let's_Encrypt_validation_server;__https://www.letsencrypt.org) 20241008033944 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 1 Cpanel-HTTP-Client/1.0 20241008033937 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 14 14 From1 2 4 From2 0 0 From3 0 0 From4 0 0 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 5 406 1 226 301 160 0 404 157 6515682 302 4 0 409 12 5464 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 71 /lib../.git/config 2 - /wordpress/wp-admin/install.php 2 www.google.com /cms/ 2 - /Adminpanel/ 2 - /control/ 2 - /wordpress/wp-includes/css/dashicons.min.css 2 www.google.com /Administrator/ 2 - /adm/ 2 - /database/.git/config 2 - /manage/ 2 - /source/.git/config 2 - /themes/.git/config 2 - /views/.git/config 2 - /drupal/sites/.git/config 2 - /Admin/ 2 - /prestashop/.git/config 2 - /panel/.git/config 2 - /manager/ 2 - /docs/.git/config 2 - /administracion/ 2 - /media../.git/config 2 - /plugins/.git/config 2 - /config/.git/config 2 - /backend/ 2 - /lib/.git/config 2 - /scripts/.git/config 2 - /template/.git/config 2 - /documentation/.git/config 2 - /modules/.git/config 2 - /img../.git/config 2 - /css../.git/config 2 - /.git/config 16 - /resources/.git/config 2 - /adminlogin/ 2 - /cache/.git/config 2 - /painel/ 2 - /common/.git/config 2 - /panel/ 2 - /backoffice/ 2 - /AdminPanel/ 2 - /admin/.git/config 2 - /cadmin/ 2 - /extensions/.git/config 2 - /events../.git/config 2 - /admin_login/ 2 - /webadmin/ 2 - /wordpress/wp-admin/setup-config.php 3 www.google.com /bower_components/.git/config 2 - /dist/.git/config 2 - /system/ 2 - /content../.git/config 2 - /Panel/ 2 - /shared/.git/config 2 - /js../.git/config 2 - /public/.git/config 2 - /media/uploads/.git/config 2 - /files/.git/config 2 - /api/.git/config 2 - /backend/.git/config 2 - /templates/.git/config 2 - /static../.git/config 2 - /data/.git/config 2 - /layout/.git/config 2 - /intranet/ 2 - /images../.git/config 2 - /adminpanel/ 2 - /Dashboard/ 2 - /js/libs/.git/config 2 - /env/.git/config 2 - /admin_panel/ 2 - /administrator/ 2 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 8 216.10.248.154 4 4 256 20241008033937 13.251.128.124 2 2 174 20241008033944 13.49.57.144 2 2 174 20241008033944 34.219.234.99 2 2 174 20241008033944 3.15.222.108 2 2 174 20241008033944 23.178.112.216 2 2 174 20241008033943 159.89.192.93 1 2 36140 20241021032359 128.199.140.193 1 2 36140 20241002155651 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 5 20241001 0 1 35623 0 20241002 1 1 517 1 20241008 14 14 1126 6 20241020 0 1 35623 0 20241021 1 1 517 1 END_DAY # Session range - Number of visits BEGIN_SESSION 1 0s-30s 8 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 4 /.well-known/acme-challenge/k3otuXDbi2CTXzzOb1aM8P8w_U58jNdtB8wBHrPJ-Do 10 870 5 5 /.well-known/acme-challenge/LKTF90XAHUQCUUHNVIHD2Q68O26U81UZ 2 128 1 0 /.well-known/acme-challenge/XJUVVQZM93W06AR5JM8L26WFUY2_V654 2 128 0 1 //wp-admin/install.php 2 1034 2 2 END_SIDER