AWSTATS DATA FILE 7.8 (build 20200416) # If you remove this file, all statistics for date 202311 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/awstats.sahyadrimahavidyalaysawarde.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2044 POS_TIME 2703 POS_VISITOR 7528 POS_DAY 10535 POS_DOMAIN 3354 POS_LOGIN 3733 POS_ROBOT 3888 POS_WORMS 4107 POS_EMAILSENDER 4238 POS_EMAILRECEIVER 4381 POS_SESSION 11167 POS_SIDER 11314 POS_FILETYPES 4516 POS_DOWNLOADS 4698 POS_OS 4746 POS_BROWSER 4903 POS_SCREENSIZE 5219 POS_UNKNOWNREFERER 5293 POS_UNKNOWNREFERERBROWSER 5947 POS_ORIGIN 6314 POS_SEREFERRALS 6451 POS_PAGEREFS 6595 POS_SEARCHWORDS 6743 POS_KEYWORDS 6895 POS_MISC 2367 POS_ERRORS 6954 POS_CLUSTER 3589 POS_SIDER_404 7076 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20231201021153 1 0 16648592672755 FirstTime 0 LastTime 20231130044157 LastUpdate 20231201181039 1 0 0 0 0 TotalVisits 73 TotalUnique 68 MonthHostsKnown 0 MonthHostsUnknown 76 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 QuickTimeSupport 0 0 0 WindowsMediaPlayerSupport 0 0 0 JavascriptDisabled 0 0 0 TotalMisc 0 0 0 DirectorSupport 0 0 0 FlashSupport 0 0 0 PDFSupport 0 0 0 RealPlayerSupport 0 0 0 JavaEnabled 0 0 0 AddToFavourites 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 23 66 26553833 7 19 7411 1 0 0 0 5 5 98543 2 0 0 0 3 3 249 3 0 0 0 8 8 98792 4 6 6 168770 1 1 83 5 2 2 27956 3 5 28755 6 0 0 0 4 6 28838 7 6 8 86097 2 4 716 8 4 6 128479 1 1 226 9 0 0 0 0 0 0 10 9 13 124516 2 8 29388 11 4 6 58141 4 6 196588 12 76 404 209510920 4 24 13992 13 6 10 88326 0 4 0 14 8 12 12069285 0 2 0 15 6 10 158664 0 4 0 16 8 17 227599 0 2 0 17 16 29 472014 0 8 2148 18 18 18 251604 0 0 0 19 12 19 227524 2 6 98562 20 4 4 126250 2 2 98294 21 10 12 282685 4 6 761 22 2 2 98294 5 5 98686 23 2 4 30185 6 8 498 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 12 us 190 601 249647993 ca 12 12 589764 cn 8 15 193306 au 2 2 27956 be 2 4 30185 eu 2 2 27956 nl 2 2 27956 ua 2 2 27956 se 2 2 27956 gb 0 4 57068 ru 0 1 32555 in 0 1 491 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 2 no_user_agent 14 688058 20231127224010 0 bot[\s_+:,\.\;\/\\-] 6 83868 20231118063514 0 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 6 woff2 45 4841964 0 0 css 81 1197207 0 0 png 34 36646 0 0 html 177 3724018 0 0 jpg 236 239510134 0 0 js 75 1381173 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 0 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 7 Unknown 532 133 linux 49 48 win10 31 20 macosx 17 6 macosx9 2 2 macosx15 11 7 android10 6 6 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 13 chrome113.0.0.0 2 2 chrome80.0.3987.162 6 6 chrome87.0.4280.88 14 4 chrome108.0.0.0 44 42 chrome107.0.0.0 5 3 chrome84.0.4147.105 19 8 chrome96.0.4664.110 6 4 netscape5.0 4 4 mozilla 518 119 chrome105.0.0.0 6 6 Unknown 12 12 firefox65.0 6 6 chrome66.0.3359.181 6 6 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 5 Mozilla/5.0_(compatible;_CensysInspect/1.1;__https://about.censys.io/) 20231124004731 Mozilla/5.0_(compatible;_InternetMeasurement/1.0;__https://internet-measurement.com/) 20231126083849 Mozilla/5.0_zgrab/0.x 20231128175113 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20231128084625 Mozilla/5.0_(compatible;_Dataprovider.com) 20231109002019 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 1 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20231128084625 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 177 218 From1 0 0 From2 0 0 From3 0 0 From4 45 430 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 4 403 2 268 404 52 26716 409 30 2490 406 5 1130 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 8 /humans.txt 6 - /.git/HEAD 2 - /ads.txt 8 - /app-ads.txt 2 - /security.txt 6 - /.well-known/security.txt 6 - /robots.txt 16 - /sitemap.xml 6 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 76 149.56.150.36 12 12 399784 20231109002000 149.56.160.228 12 12 399784 20231106124136 149.56.160.252 12 12 399784 20231106123923 149.56.160.154 7 48 26095908 20231109002019 149.56.150.182 7 48 26095908 20231106124003 149.56.150.218 7 48 26095908 20231106124030 144.217.135.169 7 48 26095908 20231106124058 144.217.135.144 7 48 26095908 20231106123945 144.217.135.199 6 47 26081930 20231106124219 149.56.150.18 6 47 26081930 20231106124315 149.56.160.167 6 47 26081930 20231106124245 184.94.240.88 6 6 168770 20231130044157 199.45.154.49 6 12 90555 20231121075710 149.56.160.144 6 47 26081930 20231106124201 35.217.79.103 4 15 231711 20231102170130 199.45.154.48 4 8 60370 20231113155640 36.99.136.129 4 4 55912 20231113191316 199.45.154.16 4 8 60370 20231123191708 143.110.208.23 2 2 27956 20231105074412 45.55.130.132 2 2 27956 20231111191248 199.244.88.223 2 2 27956 20231117113533 36.99.136.136 2 5 32551 20231109161048 205.210.31.220 2 2 98294 20231128084625 145.220.91.19 2 2 27956 20231128175113 167.71.15.21 2 2 27956 20231101183542 165.232.182.15 2 2 27956 20231129182532 199.45.154.19 2 4 30185 20231111143718 167.99.129.144 2 2 27956 20231117184216 87.236.176.98 0 1 1738 199.45.154.18 2 4 30185 20231124004728 185.166.84.142 0 1 32555 3.91.196.109 0 1 1738 174.138.33.219 2 2 27956 20231127130009 36.99.136.137 2 6 104843 20231113191317 199.45.155.32 2 4 30185 20231102165922 209.127.253.79 1 1 0 20231104104911 138.197.122.46 2 2 27956 20231115175056 35.89.101.40 2 2 27956 20231113144523 64.227.34.177 2 2 27956 20231123003926 205.210.31.38 2 2 98294 20231117211032 104.248.174.200 2 2 27956 20231108213854 198.235.24.242 2 2 98294 20231114154744 35.91.164.27 2 2 27956 20231116143919 164.92.115.237 2 2 27956 20231127194122 209.127.111.124 0 1 11878026 143.110.160.107 2 2 27956 20231119185253 15.235.9.75 2 2 36190 20231104103058 139.59.86.202 2 2 27956 20231113200126 104.236.70.180 2 2 27956 20231103180106 206.189.239.7 2 2 27956 20231109180857 199.244.88.230 2 2 27956 20231106180744 87.236.176.187 0 1 491 178.62.211.7 2 2 27956 20231119164329 146.70.192.180 0 4 57068 54.189.23.6 2 2 98294 20231111214940 174.138.82.198 2 2 27956 20231125174358 199.244.88.226 2 2 27956 20231129050424 198.235.24.34 2 2 98294 20231104201414 34.209.195.132 2 2 27956 20231125144559 199.45.155.33 2 4 30185 20231117103120 146.190.242.34 2 2 27956 20231105174425 199.45.154.17 2 4 30185 20231104130637 198.235.24.236 2 2 98294 20231114225818 193.34.75.126 2 2 27956 20231104104912 143.110.235.235 2 2 27956 20231107195501 104.131.168.104 2 2 27956 20231113073439 199.45.155.19 2 4 30185 20231119232712 94.247.172.129 2 2 27956 20231125210421 38.154.214.248 0 1 77206 165.227.37.133 2 2 27956 20231123181129 199.45.155.18 2 4 30185 20231115174438 45.139.67.144 0 1 491 87.236.176.117 2 2 27956 20231126083847 35.214.245.166 2 2 27956 20231104103055 167.71.11.50 2 2 27956 20231101180652 205.210.31.100 2 2 98294 20231118174340 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 26 20231101 4 4 55912 2 20231102 6 19 261896 2 20231103 4 6 58141 2 20231104 11 17 12178042 6 20231105 4 4 55912 2 20231106 80 410 209569061 12 20231107 2 2 27956 1 20231108 2 2 27956 1 20231109 27 77 26723291 6 20231111 6 8 156435 3 20231113 12 19 227524 6 20231114 4 4 196588 2 20231115 4 6 58141 2 20231116 4 6 58141 2 20231117 8 10 184391 4 20231118 2 2 98294 1 20231119 6 8 86097 3 20231121 2 4 30185 1 20231123 6 8 86097 3 20231124 2 4 30185 1 20231125 6 6 83868 3 20231126 2 4 30185 1 20231127 4 4 55912 2 20231128 4 4 126250 2 20231129 4 4 55912 2 20231130 6 6 168770 1 END_DAY # Session range - Number of visits BEGIN_SESSION 1 0s-30s 73 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 9 / 151 3292446 72 61 /about.html 10 180950 1 1 /vision_mission.html 10 147344 0 2 /assets/vendor/remixicon/remixicon.woff2 9 1127412 0 1 /assets/vendor/bootstrap-icons/fonts/bootstrap-icons.woff2 9 1091664 0 0 /assets/vendor/fontawesome-free/webfonts/fa-regular-400.woff2 9 227124 0 3 /assets/vendor/boxicons/fonts/boxicons.woff2 9 1041120 0 1 /assets/vendor/fontawesome-free/webfonts/fa-solid-900.woff2 9 1354644 0 4 /princi_desk.html 6 103278 0 0 END_SIDER