AWSTATS DATA FILE 7.8 (build 20200416) # If you remove this file, all statistics for date 202311 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/awstats.testsahyadrimahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2041 POS_TIME 2714 POS_VISITOR 7198 POS_DAY 8109 POS_DOMAIN 3331 POS_LOGIN 3613 POS_ROBOT 3768 POS_WORMS 3973 POS_EMAILSENDER 4104 POS_EMAILRECEIVER 4247 POS_SESSION 8509 POS_SIDER 8666 POS_FILETYPES 4382 POS_DOWNLOADS 4495 POS_OS 4543 POS_BROWSER 4632 POS_SCREENSIZE 4762 POS_UNKNOWNREFERER 4836 POS_UNKNOWNREFERERBROWSER 5499 POS_ORIGIN 6034 POS_SEREFERRALS 6166 POS_PAGEREFS 6310 POS_SEARCHWORDS 6458 POS_KEYWORDS 6610 POS_MISC 2377 POS_ERRORS 6669 POS_CLUSTER 3469 POS_SIDER_404 6798 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20231201212129 1 0 14819098328392 FirstTime 20231102092937 LastTime 20231129051300 LastUpdate 20231202181827 1 0 0 0 0 TotalVisits 34 TotalUnique 21 MonthHostsKnown 0 MonthHostsUnknown 21 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 DirectorSupport 0 0 0 WindowsMediaPlayerSupport 0 0 0 QuickTimeSupport 0 0 0 TotalMisc 0 0 0 FlashSupport 0 0 0 JavascriptDisabled 0 0 0 AddToFavourites 0 12 0 RealPlayerSupport 0 0 0 PDFSupport 0 0 0 JavaEnabled 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 3 4 88597 6 8 378274 1 4 4 378222 9 9 55774 2 0 0 0 1 1 83 3 0 0 0 2 2 166 4 2 2 377942 1 1 83 5 2 2 377942 3 3 392 6 2 2 377942 1 1 83 7 4 5 88597 0 2 0 8 3 4 88561 2 4 377942 9 5 5 84478 2 98 461083 10 6 7 466539 0 34 27776 11 6 8 177170 0 4 0 12 2 2 377942 2 2 377942 13 0 0 0 0 0 0 14 0 0 0 2 2 377942 15 2 2 84442 0 0 0 16 6 6 839942 2 2 377912 17 2 2 0 2 4 260 18 4 4 168956 0 0 0 19 4 4 755854 1 1 83 20 1 1 0 4 4 166 21 2 2 84478 3 3 377833 22 0 0 0 4 4 332 23 2 2 377942 2 2 309 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 5 us 33 39 784884 ca 22 22 4156948 nl 4 4 168956 gb 2 2 84478 my 1 1 280 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 2 no_user_agent 14 2645180 20231128002243 0 unknown 2 260 20231102170205 2 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 3 html 47 5170832 0 0 php 15 0 0 0 png 6 24714 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 0 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 2 linux 9 9 Unknown 59 53 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 5 chrome108.0.0.0 8 8 netscape5.0 4 4 firefox95.0 1 1 mozilla 18 12 Unknown 37 37 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 5 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20231129051300 WordPress/6.4.1;_https://testsahyadrimahavidyalay.ptechinstitute.com 20231128101836 WordPress/6.3.2;_https://testsahyadrimahavidyalay.ptechinstitute.com 20231107083456 Mozilla/5.0_(compatible;_CensysInspect/1.1;__https://about.censys.io/) 20231128101838 Mozilla/5.0_zgrab/0.x 20231126212424 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 3 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20231129051300 WordPress/6.4.1;_https://testsahyadrimahavidyalay.ptechinstitute.com 20231128101836 WordPress/6.3.2;_https://testsahyadrimahavidyalay.ptechinstitute.com 20231107083456 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 62 62 From1 0 0 From2 0 0 From3 0 0 From4 0 6 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 5 404 6 166717 301 132 0 409 22 1826 406 2 452 302 1 0 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 2 / 2 http://www.testsahyadrimahavidyalay.ptechinstitute.com/// /wp-emoji-release.min.js 4 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 21 216.10.248.154 15 15 0 20231128101836 199.45.155.19 6 9 265767 20231128101831 198.235.24.254 4 4 755884 20231129051300 145.220.91.19 4 4 168956 20231126212424 206.189.107.178 2 2 84478 20231117184836 128.199.28.63 2 2 84478 20231121090624 198.235.24.168 2 2 377942 20231118195005 205.210.31.80 2 2 377942 20231126010955 198.235.24.115 2 2 377942 20231121124852 198.235.24.203 2 2 377912 20231111192416 198.235.24.42 2 2 377942 20231115042901 199.45.155.16 2 3 88561 20231107083452 198.235.24.243 2 2 377942 20231115065409 198.235.24.39 2 2 377750 20231107160254 199.45.154.18 2 3 88597 20231117111344 104.248.91.219 2 2 84442 20231103162712 198.235.24.105 2 2 377942 20231117103329 137.184.37.72 2 2 84442 20231107155704 199.45.155.18 2 3 88597 20231128073602 205.210.31.209 2 2 377750 20231104165615 111.90.150.36 1 1 280 20231114014426 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 16 20231102 6 6 0 2 20231103 2 2 84442 1 20231104 2 2 377750 1 20231107 7 8 550753 4 20231111 2 2 377912 1 20231113 3 4 88573 2 20231114 3 3 280 3 20231115 4 4 755884 2 20231117 10 12 639614 6 20231118 2 2 377942 1 20231121 4 4 462420 2 20231122 2 2 377942 1 20231125 2 2 84478 1 20231126 4 4 462420 2 20231128 7 9 177194 4 20231129 2 2 377942 1 END_DAY # Session range - Number of visits BEGIN_SESSION 2 0s-30s 33 30mn-1h 1 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 3 / 46 5170552 23 23 /wp-cron.php 15 0 10 10 //wp-json/wp/v2/users/ 1 280 1 0 END_SIDER