AWSTATS DATA FILE 7.8 (build 20200416) # If you remove this file, all statistics for date 202411 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/awstats.adhyapakmahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2037 POS_TIME 2682 POS_VISITOR 6662 POS_DAY 6734 POS_DOMAIN 3182 POS_LOGIN 3393 POS_ROBOT 3548 POS_WORMS 3755 POS_EMAILSENDER 3886 POS_EMAILRECEIVER 4029 POS_SESSION 6790 POS_SIDER 6927 POS_FILETYPES 4164 POS_DOWNLOADS 4228 POS_OS 4276 POS_BROWSER 4341 POS_SCREENSIZE 4391 POS_UNKNOWNREFERER 4465 POS_UNKNOWNREFERERBROWSER 4552 POS_ORIGIN 4634 POS_SEREFERRALS 4764 POS_PAGEREFS 4908 POS_SEARCHWORDS 5056 POS_KEYWORDS 5208 POS_MISC 2346 POS_ERRORS 5267 POS_CLUSTER 3249 POS_SIDER_404 5387 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20241201074552 1 0 8106241223623 FirstTime 0 LastTime 0 LastUpdate 20241201183036 1 0 0 0 0 TotalVisits 0 TotalUnique 0 MonthHostsKnown 0 MonthHostsUnknown 0 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 DirectorSupport 0 0 0 PDFSupport 0 0 0 FlashSupport 0 0 0 JavascriptDisabled 0 0 0 RealPlayerSupport 0 0 0 AddToFavourites 0 2 0 JavaEnabled 0 0 0 QuickTimeSupport 0 0 0 WindowsMediaPlayerSupport 0 0 0 TotalMisc 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 0 0 0 0 0 0 1 0 0 0 0 0 0 2 0 0 0 2 2 0 3 0 0 0 0 0 0 4 0 0 0 6 6 309 5 0 0 0 2 2 0 6 0 0 0 11 11 83 7 0 0 0 3 3 83 8 0 0 0 2 2 0 9 0 0 0 4 6 36940 10 0 0 0 8 10 220 11 0 0 0 2 2 0 12 0 0 0 2 2 0 13 0 0 0 0 0 0 14 0 0 0 0 0 0 15 0 0 0 2 2 0 16 0 0 0 4 4 0 17 0 0 0 2 2 0 18 0 0 0 4 6 0 19 0 0 0 80 80 1402070 20 0 0 0 0 0 0 21 0 0 0 0 0 0 22 0 0 0 2 4 220 23 0 0 0 0 0 0 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 0 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 2 unknown 2 220 20241113105337 2 bot[\s_+:,\.\;\/\\-] 2 220 20241113223911 2 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 0 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 0 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 0 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 0 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 0 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 0 0 From1 0 0 From2 0 0 From3 0 0 From4 0 0 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 4 409 3 249 406 1 226 301 56 0 404 78 1439010 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 39 /template/.git/config 2 - /shared/.git/config 2 - /themes/.git/config 2 - /files/.git/config 2 - /documentation/.git/config 2 - /bower_components/.git/config 2 - /admin/.git/config 2 - /database/.git/config 2 - /docs/.git/config 2 - /content../.git/config 2 - /cache/.git/config 2 - /media/uploads/.git/config 2 - /scripts/.git/config 2 - /lib/.git/config 2 - /ads.txt 2 - /source/.git/config 2 - /events../.git/config 2 - /extensions/.git/config 2 - /views/.git/config 2 - /prestashop/.git/config 2 - /config/.git/config 2 - /env/.git/config 2 - /layout/.git/config 2 - /dist/.git/config 2 - /backend/.git/config 2 - /common/.git/config 2 - /lib../.git/config 2 - /resources/.git/config 2 - /js/libs/.git/config 2 - /api/.git/config 2 - /data/.git/config 2 - /modules/.git/config 2 - /plugins/.git/config 2 - /drupal/sites/.git/config 2 - /public/.git/config 2 - /templates/.git/config 2 - /panel/.git/config 2 - /media../.git/config 2 - /static../.git/config 2 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 0 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 0 END_DAY # Session range - Number of visits BEGIN_SESSION 0 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 0 END_SIDER