AWSTATS DATA FILE 7.8 (build 20200416) # If you remove this file, all statistics for date 202312 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/awstats.testsahyadrimahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2041 POS_TIME 2715 POS_VISITOR 7947 POS_DAY 9122 POS_DOMAIN 3345 POS_LOGIN 3641 POS_ROBOT 3796 POS_WORMS 4044 POS_EMAILSENDER 4175 POS_EMAILRECEIVER 4318 POS_SESSION 9520 POS_SIDER 9687 POS_FILETYPES 4453 POS_DOWNLOADS 4603 POS_OS 4651 POS_BROWSER 4800 POS_SCREENSIZE 5077 POS_UNKNOWNREFERER 5151 POS_UNKNOWNREFERERBROWSER 5955 POS_ORIGIN 6528 POS_SEREFERRALS 6662 POS_PAGEREFS 6806 POS_SEARCHWORDS 6954 POS_KEYWORDS 7106 POS_MISC 2379 POS_ERRORS 7165 POS_CLUSTER 3497 POS_SIDER_404 7289 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20240101023322 5 1032 8592512262150 FirstTime 20231201212129 LastTime 20231231211613 LastUpdate 20240101181208 5 0 4 0 0 TotalVisits 37 TotalUnique 28 MonthHostsKnown 0 MonthHostsUnknown 28 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 PDFSupport 0 0 0 QuickTimeSupport 0 0 0 JavaEnabled 0 0 0 AddToFavourites 0 4 0 JavascriptDisabled 0 0 0 FlashSupport 0 0 0 TotalMisc 0 0 0 RealPlayerSupport 0 0 0 DirectorSupport 0 0 0 WindowsMediaPlayerSupport 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 2 2 390270 0 0 0 1 0 0 0 3 3 249 2 0 0 0 3 3 390353 3 27 33 3997032 88 88 1710743 4 2 2 390270 0 68 27861 5 7 7 744336 58 58 1307323 6 2 2 390270 0 64 27860 7 3 3 82670 3 9 111949 8 3 4 95515 0 34 0 9 4 5 95515 1 3 83 10 0 0 0 0 0 0 11 4 4 166289 2 2 390270 12 0 0 0 2 2 390270 13 3 3 390270 29 29 1033718 14 4 4 165360 0 0 0 15 1 1 0 2 2 0 16 0 0 0 0 0 0 17 0 0 0 0 0 0 18 2 2 91390 0 0 0 19 25 25 0 2 113 487015 20 4 4 182786 3 40 28109 21 6 6 263594 2 2 166 22 2 2 0 3 3 83 23 2 2 84478 3 37 28110 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 6 us 79 87 5445842 ca 8 8 1262200 au 4 4 469338 nl 4 4 173201 cn 4 4 179116 zz 4 4 348 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 3 Go\-http\-client/ 24 7656 20231224132153 0 no_user_agent 20 3841840 20231224132137 0 unknown 2 260 20231210072043 2 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 5 Unknown 16 1300 0 0 jpg 6 2810601 0 0 html 48 4709906 0 0 png 2 8238 0 0 php 39 0 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 0 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 6 win10 16 10 macosx6 2 2 androidmarshmallow 12 12 linux 10 10 win7 2 2 Unknown 69 67 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 11 chrome79.0.3945.79 2 2 netscape5.0 2 2 mozilla 18 16 chrome83.0.4103.61 2 2 safari5.0.4 2 2 chrome117.0.5938.132 8 2 chrome92.0.4515.107 4 4 Unknown 49 49 chrome84.0.4147.105 2 2 chrome108.0.0.0 10 10 chrome52.0.3624.98 12 12 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 7 WordPress/6.4.1;_https://testsahyadrimahavidyalay.ptechinstitute.com 20231204154652 Mozilla/5.0_(compatible;_CensysInspect/1.1;__https://about.censys.io/) 20231229090448 Mozilla/5.0_zgrab/0.x 20231211114526 Cpanel-HTTP-Client/1.0 20231208033545 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20231229060907 WordPress/6.4.2;_https://testsahyadrimahavidyalay.ptechinstitute.com 20231229090450 Mozilla/5.0_(compatible;_Let's_Encrypt_validation_server;__https://www.letsencrypt.org) 20231208033549 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 4 Cpanel-HTTP-Client/1.0 20231208033545 WordPress/6.4.1;_https://testsahyadrimahavidyalay.ptechinstitute.com 20231204154652 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20231229060907 WordPress/6.4.2;_https://testsahyadrimahavidyalay.ptechinstitute.com 20231229090450 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 103 103 From1 0 0 From2 0 0 From3 0 0 From4 0 8 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 4 404 71 2081390 409 20 1660 406 6 1356 301 413 0 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 14 /ads.txt 2 - /.git/config 6 - /s/730323e2834323e20313e2631323/_/ 6 - /v2/_catalog 6 - /telescope/requests 6 - /.vscode/sftp.json 3 - /login.action 6 - /config.json 3 - /debug/default/view 6 - /wp-emoji-release.min.js 7 - /_all_dbs 6 - /ecp/Current/exporttool/microsoft.exchange.ediscovery.exporttool.application 6 - /app-ads.txt 2 - /.DS_Store 6 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 28 216.10.248.154 43 43 256 20231229090450 34.215.117.148 4 4 348 20231208033549 13.58.123.234 4 4 348 20231208033549 205.169.39.197 4 4 165360 20231208143451 206.81.1.88 2 2 363314 20231224030756 139.59.153.118 2 2 91396 20231229202427 199.45.155.18 2 3 95515 20231229090441 159.203.41.26 2 2 84478 20231205230740 167.99.8.63 2 2 390270 20231224132139 138.68.163.10 2 2 361195 20231208033615 23.178.112.200 2 2 174 20231208033549 144.126.202.105 2 2 372168 20231212050225 99.81.216.206 2 2 84478 20231202115842 111.7.100.27 2 2 91396 20231231211611 205.210.31.251 2 2 390270 20231223005404 199.45.155.16 2 3 95515 20231228085840 205.210.31.193 2 2 390270 20231229040539 159.89.90.17 2 2 91390 20231215200451 139.59.182.142 2 2 377942 20231208033615 164.90.222.93 2 2 372168 20231212054751 65.154.226.169 2 8 2893281 20231208035111 137.184.220.134 2 2 84478 20231201212129 145.220.91.19 2 2 81811 20231211114526 35.217.53.246 2 2 82670 20231210072042 111.7.100.26 2 2 87720 20231231211614 205.210.31.234 2 2 390270 20231229060907 46.101.9.27 2 2 91390 20231219180840 23.178.112.201 2 2 174 20231208033549 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 16 20231201 2 2 84478 1 20231202 2 2 84478 1 20231204 1 1 0 1 20231205 2 2 84478 1 20231208 28 34 3799078 9 20231210 3 3 82670 2 20231211 2 2 81811 1 20231212 7 7 744336 3 20231215 27 27 91390 2 20231219 2 2 91390 1 20231222 2 2 0 1 20231223 2 2 390270 1 20231224 6 6 753584 4 20231228 3 4 95515 2 20231229 10 11 967451 5 20231231 4 4 179116 2 END_DAY # Session range - Number of visits BEGIN_SESSION 3 30mn-1h 1 30s-2mn 2 0s-30s 34 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 6 / 48 4709906 23 23 /wp-cron.php 39 0 9 10 /.well-known/acme-challenge/Qj786t-y4E6aWC-My0mrkIR_no8EY1e_JgM7vaI3_NI 6 522 3 1 /.well-known/acme-challenge/TiOAEavU0lYt05MUD8HJa54JZuaX-FArewOtzl1CV4c 6 522 1 3 /.well-known/acme-challenge/QZFSGPG3JJKI0JH6IGVM6XQFSAXF39EH 2 128 0 0 /.well-known/acme-challenge/0OYVMQCRI-1MEEHH_I15MT_CQ1TCYE8N 2 128 1 0 END_SIDER