AWSTATS DATA FILE 7.8 (build 20200416) # If you remove this file, all statistics for date 202412 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/awstats.testsahyadrimahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2041 POS_TIME 2700 POS_VISITOR 6167 POS_DAY 6461 POS_DOMAIN 3233 POS_LOGIN 3479 POS_ROBOT 3634 POS_WORMS 3885 POS_EMAILSENDER 4016 POS_EMAILRECEIVER 4159 POS_SESSION 6539 POS_SIDER 6685 POS_FILETYPES 4294 POS_DOWNLOADS 4378 POS_OS 4426 POS_BROWSER 4505 POS_SCREENSIZE 4581 POS_UNKNOWNREFERER 4655 POS_UNKNOWNREFERERBROWSER 4883 POS_ORIGIN 5003 POS_SEREFERRALS 5135 POS_PAGEREFS 5279 POS_SEARCHWORDS 5427 POS_KEYWORDS 5579 POS_MISC 2364 POS_ERRORS 5638 POS_CLUSTER 3335 POS_SIDER_404 5769 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20250101175821 1 0 21445818827540 FirstTime 0 LastTime 20241208034059 LastUpdate 20250101182848 1 0 0 0 0 TotalVisits 6 TotalUnique 6 MonthHostsKnown 0 MonthHostsUnknown 6 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 AddToFavourites 0 4 0 JavaEnabled 0 0 0 RealPlayerSupport 0 0 0 TotalMisc 0 0 0 DirectorSupport 0 0 0 PDFSupport 0 0 0 FlashSupport 0 0 0 JavascriptDisabled 0 0 0 WindowsMediaPlayerSupport 0 0 0 QuickTimeSupport 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 0 0 0 6 6 0 1 0 0 0 4 5 226 2 0 0 0 2 2 0 3 14 14 1126 16 16 0 4 0 0 0 4 8 246 5 0 0 0 4 6 246 6 0 0 0 2 2 83644 7 0 0 0 0 0 0 8 0 0 0 10 10 452 9 0 0 0 4 4 83644 10 0 0 0 10 10 43022 11 0 0 0 6 10 411538 12 0 0 0 6 6 0 13 0 0 0 6 6 0 14 0 0 0 6 6 452 15 0 0 0 2 2 0 16 0 0 0 2 2 0 17 0 0 0 14 18 246 18 0 0 0 2 2 0 19 0 0 0 4 4 0 20 0 0 0 10 13 126144 21 0 0 0 10 10 0 22 0 0 0 14 15 535 23 0 0 0 2 2 0 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 3 us 10 10 778 zz 2 2 174 gb 2 2 174 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 3 facebookexternalhit/ 4 512 20241217113430 4 unknown 4 492 20241218170740 4 bot[\s_+:,\.\;\/\\-] 2 246 20241212055630 2 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 1 Unknown 14 1126 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 0 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 1 Unknown 14 14 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 2 mozilla 10 10 Unknown 4 4 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 2 Cpanel-HTTP-Client/1.0 20241208034042 Mozilla/5.0_(compatible;_Let's_Encrypt_validation_server;__https://www.letsencrypt.org) 20241208034059 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 1 Cpanel-HTTP-Client/1.0 20241208034042 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 14 14 From1 0 0 From2 0 0 From3 0 0 From4 0 0 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 5 404 10 745602 406 10 2260 301 128 0 409 2 1283 302 1 0 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 4 /wordpress/wp-admin/setup-config.php 1 - /sitemap 2 - /.git/config 6 - /wp-admin.php 1 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 6 216.10.248.154 4 4 256 20241208034042 51.20.140.103 2 2 174 20241208034049 23.178.112.213 2 2 174 20241208034048 54.255.193.183 2 2 174 20241208034049 35.92.89.7 2 2 174 20241208034049 18.117.255.46 2 2 174 20241208034059 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 1 20241208 14 14 1126 6 END_DAY # Session range - Number of visits BEGIN_SESSION 1 0s-30s 6 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 3 /.well-known/acme-challenge/_rzGxuGWCvW-S3J4xXJisnPsdvYQDhlh_q5XxQWA7dQ 10 870 5 5 /.well-known/acme-challenge/VNAT2D3A7I4T6HQJ916TTMCU1MECOGHU 2 128 0 1 /.well-known/acme-challenge/AQSNGRH83TIR7J-HLGM9NOZEYCKTSND8 2 128 1 0 END_SIDER