AWSTATS DATA FILE 7.8 (build 20200416) # If you remove this file, all statistics for date 202401 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/ssl/awstats.sahyadrimahavidyalaysawarde.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2048 POS_TIME 2720 POS_VISITOR 8550 POS_DAY 11361 POS_DOMAIN 3428 POS_LOGIN 3749 POS_ROBOT 3904 POS_WORMS 4121 POS_EMAILSENDER 4252 POS_EMAILRECEIVER 4395 POS_SESSION 11998 POS_SIDER 12155 POS_FILETYPES 4530 POS_DOWNLOADS 4747 POS_OS 4795 POS_BROWSER 4964 POS_SCREENSIZE 5311 POS_UNKNOWNREFERER 5385 POS_UNKNOWNREFERERBROWSER 5901 POS_ORIGIN 6268 POS_SEREFERRALS 6405 POS_PAGEREFS 6549 POS_SEARCHWORDS 6697 POS_KEYWORDS 6849 POS_MISC 2384 POS_ERRORS 6908 POS_CLUSTER 3605 POS_SIDER_404 7033 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20240201022335 1 0 18214662905374 FirstTime 20240101041446 LastTime 20240131173135 LastUpdate 20240201182322 1 0 0 0 0 TotalVisits 73 TotalUnique 68 MonthHostsKnown 0 MonthHostsUnknown 70 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 AddToFavourites 0 0 0 JavaEnabled 0 0 0 DirectorSupport 0 0 0 QuickTimeSupport 0 0 0 RealPlayerSupport 0 0 0 JavascriptDisabled 0 0 0 WindowsMediaPlayerSupport 0 0 0 FlashSupport 0 0 0 TotalMisc 0 0 0 PDFSupport 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 4 4 55912 10 10 198736 1 4 4 126250 2 4 1882 2 0 0 0 14 14 4611 3 0 0 0 10 12 4345 4 2 4 30185 8 10 100442 5 4 6 128479 4 6 1432 6 4 4 196588 4 4 1432 7 6 6 224544 8 8 295598 8 2 2 98294 6 6 99325 9 2 4 30185 12 14 101072 10 6 6 294882 6 6 196903 11 0 0 0 8 8 100442 12 43 157 69080581 6 13 20390302 13 2 3 28447 5 5 1484 14 18 18 251604 8 10 2864 15 8 10 184391 7 9 99952 16 23 75 26507898 10 16 59226 17 15 63 26391616 5 5 99236 18 8 8 182162 11 11 296276 19 18 18 392280 7 7 99952 20 6 8 156435 2 4 716 21 10 12 282685 2 14 101874 22 10 10 421132 0 2 1166 23 4 4 196588 0 0 0 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 7 us 93 150 27667538 in 48 203 95148533 ca 38 38 1867586 cn 12 27 465657 ru 4 4 55912 au 2 2 27956 md 2 2 27956 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 2 no_user_agent 38 1867586 20240129181342 0 Go\-http\-client/ 4 55912 20240127165000 0 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 8 png 22 22025 0 0 ttf 8 1838960 0 0 jpg 127 114187094 0 0 woff 6 1316496 0 0 woff2 25 2689980 0 0 js 42 791385 0 0 html 160 3883106 0 0 css 36 532092 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 0 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 8 macosx 16 4 Unknown 72 56 ios_iphone 4 4 macosx15 9 6 linux 90 49 android10 95 23 win7 2 2 win10 138 55 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 14 safari16.5 4 4 chrome121.0.0.0 48 7 chrome87.0.4280.88 16 4 chrome78.0.3880.0 2 2 chrome100.0.4896.60 8 8 Unknown 38 38 chrome96.0.4664.110 9 6 chrome83.0.4103.97 4 4 chrome108.0.0.0 38 38 mozilla 34 18 chrome102.0.0.0 6 6 chrome71.0.2623.112 2 2 chrome66.0.3359.181 14 14 chrome120.0.0.0 203 48 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 3 Mozilla/5.0_(compatible;_Dataprovider.com) 20240109153228 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20240131173135 Mozilla/5.0_(compatible;_CensysInspect/1.1;__https://about.censys.io/) 20240131161832 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 1 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20240131173135 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 160 179 From1 0 0 From2 0 0 From3 0 0 From4 39 247 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 4 404 124 43385 206 7 20290977 400 1 52 406 6 1356 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 44 /vendor/swiper/swiper-bundle.min.js 1 - //ajax.googleapis.com/ajax/libs/jquery/3.6.3/jquery.min.js 1 - /___proxy_subdomain_cpcontacts/ 1 - /.git/config 6 - /test/.git/config 2 - /vendor/glightbox/js/glightbox.min.js 1 - /images/.git/config 2 - /css/.git/config 2 - /core/.git/config 8 - /backup/.git/config 4 - /uploads/.git/config 2 - /includes/.git/config 2 - //maxcdn.bootstrapcdn.com/bootstrap/3.4.1/js/bootstrap.min.js 1 - /vendor/bootstrap/js/bootstrap.bundle.min.js 1 - /dev/.git/config 4 - /utils/.git/config 2 - /vendor/php-email-form/validate.js 1 - /___proxy_subdomain_webmail/ 3 - /admin/.git/config 4 - /vendor/purecounter/purecounter_vanilla.js 1 - /dist/.git/config 2 - /js/main.js 1 - /app/.git/config 8 - /src/.git/config 2 - /.svn/wc.db 6 - /data/.git/config 2 - /vendor/.git/config 2 - /___proxy_subdomain_webdisk/ 1 - /robots.txt 10 - /plugins/.git/config 2 - /___proxy_subdomain_cpanel/ 1 - /lib/.git/config 2 - /scripts/.git/config 2 - /blogs/.git/config 2 - / 7 - /assets/.git/config 2 - /system/.git/config 4 - /info/.git/config 2 - /views/.git/config 2 - /___proxy_subdomain_cpcalendars/ 1 - /include/.git/config 2 - /files/.git/config 2 - /www/.git/config 2 - /api/.git/config 8 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 70 115.96.208.162 48 203 95148533 20240130174444 35.171.144.152 8 8 393176 20240126061549 35.165.215.140 7 48 26095908 20240127165005 198.235.24.127 4 4 196588 20240120052718 198.235.24.219 4 4 196588 20240127103033 185.195.232.153 4 4 55912 20240123160242 167.248.133.38 2 4 30185 20240131161823 34.212.75.8 2 2 27956 20240118143318 139.59.27.242 2 2 27956 20240112202559 198.235.24.40 2 2 98294 20240106101836 198.235.24.122 2 2 98294 20240113222104 149.56.160.163 2 2 98294 20240109153228 143.198.231.159 2 2 27956 20240104220331 198.235.24.75 2 2 98294 20240110010407 101.68.211.2 2 2 98294 20240102212213 198.235.24.52 2 2 98294 20240103074722 36.99.136.136 2 5 51366 20240131160923 54.185.93.191 2 2 27956 20240103143559 198.235.24.211 2 2 98294 20240113102608 35.89.36.192 2 2 27956 20240112142403 198.199.88.237 2 2 27956 20240122161611 205.210.31.88 2 2 98294 20240131173136 198.199.73.145 2 2 27956 20240128185143 165.232.142.177 2 2 27956 20240109011607 176.123.7.11 2 2 27956 20240117213605 199.45.155.33 2 4 30185 20240117202106 68.183.45.42 2 2 27956 20240131154332 18.237.51.0 2 2 27956 20240115144647 104.248.253.121 2 2 27956 20240104000419 205.210.31.208 2 2 98294 20240113214922 34.219.230.25 2 2 27956 20240109144734 138.197.82.59 2 2 27956 20240120181745 36.99.136.129 2 2 27956 20240115134926 199.45.155.18 2 4 30185 20240114155207 198.235.24.68 2 2 98294 20240105233930 143.244.179.175 2 2 27956 20240126192344 165.22.235.5 2 2 27956 20240108192926 199.45.155.32 2 4 30185 20240102162341 71.6.134.235 2 2 27956 20240123004203 143.244.170.245 2 2 27956 20240128164432 64.227.32.92 2 2 27956 20240122183127 68.183.134.104 2 2 27956 20240118192752 159.203.39.183 2 2 27956 20240114122553 138.68.141.155 2 2 27956 20240116174620 54.184.229.108 2 2 27956 20240112145015 205.210.31.199 2 2 98294 20240120233439 111.7.100.29 2 3 29550 20240117171701 199.45.154.49 2 4 30185 20240123052939 198.235.24.60 2 2 98294 20240110205541 111.7.100.30 0 3 88091 111.7.100.31 0 2 22919 34.216.173.101 2 2 27956 20240118142512 205.210.31.163 2 2 98294 20240105071425 34.221.133.254 2 2 27956 20240124142806 199.45.155.17 2 4 30185 20240131093045 159.65.244.94 2 2 27956 20240117193310 198.235.24.179 2 2 98294 20240123195311 104.248.207.90 2 2 27956 20240114191850 71.6.134.231 2 2 27956 20240103073621 35.167.197.111 2 2 27956 20240130150857 205.210.31.220 2 2 98294 20240109185541 199.45.155.34 2 4 30185 20240102212855 199.45.154.17 2 4 30185 20240101041446 198.235.24.119 2 2 98294 20240116081837 71.6.134.234 2 2 27956 20240122211359 36.99.136.137 2 7 118583 20240131160920 138.68.141.203 2 2 27956 20240124190207 111.7.100.28 2 3 28898 20240117171706 198.235.24.163 2 2 98294 20240109161420 137.184.161.1 2 2 27956 20240130194657 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 26 20240101 2 4 30185 1 20240102 6 10 158664 3 20240103 6 6 154206 3 20240104 4 4 55912 2 20240105 4 4 196588 2 20240106 2 2 98294 1 20240108 2 2 27956 1 20240109 10 10 350794 5 20240110 4 4 196588 2 20240112 6 6 83868 3 20240113 8 8 393176 4 20240114 6 8 86097 3 20240115 4 5 56403 2 20240116 6 6 224544 3 20240117 10 19 255555 5 20240118 6 6 83868 3 20240120 6 6 224544 3 20240122 6 6 83868 3 20240123 51 167 69264972 6 20240124 4 4 55912 2 20240125 4 4 196588 1 20240126 6 6 224544 2 20240127 9 50 26194202 2 20240128 4 4 55912 2 20240130 11 52 26151820 3 20240131 12 23 356078 6 END_DAY # Session range - Number of visits BEGIN_SESSION 2 0s-30s 72 2mn-5mn 1 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 11 / 160 3883106 73 71 /assets/vendor/boxicons/fonts/boxicons.woff2 5 578400 0 2 /assets/vendor/fontawesome-free/webfonts/fa-solid-900.woff2 5 752580 0 0 /assets/vendor/remixicon/remixicon.woff2 5 626340 0 0 /assets/vendor/bootstrap-icons/fonts/bootstrap-icons.woff2 5 606480 0 0 /assets/vendor/fontawesome-free/webfonts/fa-regular-400.woff2 5 126180 0 0 /assets/vendor/fontawesome-free/webfonts/fa-solid-900.ttf 4 1589680 0 0 /assets/vendor/fontawesome-free/webfonts/fa-regular-400.ttf 4 249280 0 0 /assets/vendor/bootstrap-icons/fonts/bootstrap-icons.woff 2 328704 0 0 /assets/vendor/boxicons/fonts/boxicons.woff 2 642040 0 0 /assets/vendor/remixicon/remixicon.woff 2 345752 0 0 END_SIDER