AWSTATS DATA FILE 7.8 (build 20200416) # If you remove this file, all statistics for date 202401 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/ssl/awstats.testsahyadrimahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2045 POS_TIME 2725 POS_VISITOR 9100 POS_DAY 11246 POS_DOMAIN 3511 POS_LOGIN 3870 POS_ROBOT 4025 POS_WORMS 4273 POS_EMAILSENDER 4404 POS_EMAILRECEIVER 4547 POS_SESSION 11929 POS_SIDER 12125 POS_FILETYPES 4682 POS_DOWNLOADS 5053 POS_OS 5295 POS_BROWSER 5505 POS_SCREENSIZE 5998 POS_UNKNOWNREFERER 6072 POS_UNKNOWNREFERERBROWSER 6732 POS_ORIGIN 7301 POS_SEREFERRALS 7446 POS_PAGEREFS 7590 POS_SEARCHWORDS 7781 POS_KEYWORDS 7933 POS_MISC 2388 POS_ERRORS 7992 POS_CLUSTER 3726 POS_SIDER_404 8185 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20240201102931 78 29177 17293267779242 FirstTime 20240101120942 LastTime 20240131214635 LastUpdate 20240201182327 78 0 77 0 0 TotalVisits 116 TotalUnique 48 MonthHostsKnown 0 MonthHostsUnknown 51 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 AddToFavourites 0 62 0 QuickTimeSupport 0 0 0 JavaEnabled 0 0 0 WindowsMediaPlayerSupport 0 0 0 FlashSupport 0 0 0 DirectorSupport 0 0 0 TotalMisc 0 0 0 JavascriptDisabled 0 0 0 RealPlayerSupport 0 0 0 PDFSupport 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 5 5 56753 8 8 390477 1 0 0 0 3 4 475 2 8 156 4529672 4 10 830 3 2 2 415214 2 2 166 4 3 3 91512 2 36 332 5 2 2 2554 2 3 392 6 3 3 390270 32 32 392027 7 13 96 5250146 35 38 1426166 8 13 100 5320543 6 8 641 9 92 566 18859909 20 50 10591 10 308 1038 28446618 24 30 781702 11 1074 2391 47564578 33 41 1079 12 1110 1592 30970036 54 63 732227 13 192 203 1647072 11 13 34328 14 173 259 6146039 17 19 416999 15 845 1663 37234506 29 33 64941 16 804 1506 31178216 17 21 890 17 1153 1804 32102866 11 15 20355 18 108 525 25668417 4 15 701 19 2 2 91392 4 4 332 20 10 93 4777907 6 8 332 21 7 58 2084716 6 6 415546 22 9 10 577575 35 37 1035679 23 5 16 2776126 34 37 786399 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 9 in 4390 9381 224964921 us 1494 2418 46774776 jp 37 219 10943795 ca 8 11 1940786 au 3 3 56753 gb 3 3 392824 cn 2 54 925596 md 2 2 91512 ru 2 2 91674 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 3 no_user_agent 25 4753605 20240130123356 0 Go\-http\-client/ 16 5128 20240107072333 0 unknown 2 260 20240103091911 2 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 15 png 411 34598981 0 0 gif 26 148306 0 0 jpg 428 87161846 0 0 webp 74 518660 0 0 css 1395 8948154 0 0 html 927 40667244 0 0 woff 74 1160940 0 0 svg 56 210009 0 0 jpeg 38 1500210 0 0 Unknown 735 2077277 0 0 pdf 8 4335302 0 0 php 4020 51462701 0 0 js 3716 44644879 0 0 woff2 159 7338312 0 0 ttf 26 1409816 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 3 /wp-content/uploads/2024/01/Department-of-English-CO.pdf 4 0 1608668 /wp-content/uploads/2024/01/Information-Handbook-of-RTI.pdf 3 0 2693067 /wp-content/uploads/2024/01/Jadhav-S-M.pdf 1 0 33567 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 9 androidmarshmallow 8 8 linux 20 18 ios_iphone 2 2 win10 9703 4440 android 182 15 androidoreo 187 18 win7 55 3 android10 543 53 Unknown 1393 1384 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 20 chrome91.0.4472.88 187 18 chrome52.0.3624.98 8 8 chrome63.0.3239.132 52 0 chrome84.0.4147.105 57 6 chrome75.0.3770.100 2 2 chrome71.0.2623.112 2 2 safari16.5 2 2 chrome109.0.0.0 188 42 chrome120.0.0.0 3813 971 chrome121.0.0.0 5755 3437 firefox95.0 3 3 mozilla 19 10 chrome115.0.0.0 182 15 Unknown 1374 1374 chrome118.0.0.0 193 26 chrome79.0.3945.117 1 1 chrome108.0.0.0 6 6 chrome117.0.5938.132 156 8 chrome102.0.0.0 2 2 chrome114.0.0.0 91 8 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 5 WordPress/6.4.3;_https://testsahyadrimahavidyalay.ptechinstitute.com 20240131214636 WordPress/6.4.2;_https://testsahyadrimahavidyalay.ptechinstitute.com 20240131100151 WhatsApp/2.23.20.0 20240123224829 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20240130033714 Mozilla/5.0_(compatible;_CensysInspect/1.1;__https://about.censys.io/) 20240130100216 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 4 WordPress/6.4.3;_https://testsahyadrimahavidyalay.ptechinstitute.com 20240131214636 WordPress/6.4.2;_https://testsahyadrimahavidyalay.ptechinstitute.com 20240131100151 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20240130033714 WhatsApp/2.23.20.0 20240123224829 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 1473 1575 From1 2 2 From2 0 0 From3 63 63 From4 4403 10453 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 1 https://md-in-74.webhostbox.net:2083 63 63 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 10 206 4 2420 405 1 0 421 20 6440 201 1 947 409 149 12367 406 13 2712 302 99 376854 404 48 1351746 301 92 0 500 1 1128 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 17 /.git/config 6 - /v2/_catalog 4 - /.DS_Store 4 - /wp-json/wp/v2/media/127 1 https://testsahyadrimahavidyalay.ptechinstitute.com/wp-admin/post.php /wp-admin/admin-ajax.php 1 https://testsahyadrimahavidyalay.ptechinstitute.com/wp-admin/customize.php /.vscode/sftp.json 2 - /config.json 2 - /wp-content/plugins/better-search-replace/README.txt 1 - /.git/index 1 - /ecp/Current/exporttool/microsoft.exchange.ediscovery.exporttool.application 4 - /login.action 4 - /_all_dbs 4 - /wp-content/backups-dup-lite/tmp/ 1 - /debug/default/view 4 - / 1 - /s/730323e2834323e20313e2631323/_/ 4 - /telescope/requests 4 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 51 115.96.208.162 4181 8211 169655891 20240131181005 216.10.248.154 1360 1360 1467933 20240131214636 103.176.135.78 95 484 23971947 20240124170654 152.57.82.189 37 331 10838322 20240115095604 103.176.135.73 30 152 7076163 20240131162850 49.38.128.123 28 172 5076549 20240111154000 103.31.40.22 21 60 704374 20240125094500 152.57.198.227 18 105 5941793 20240123175711 106.220.158.102 16 100 5084388 20240123181939 103.31.40.23 16 159 10239421 20240113142930 49.38.140.191 12 12 391672 20240111161941 152.57.103.176 12 97 4948831 20240123184037 106.210.243.173 10 93 4883661 20240124085446 103.176.135.74 10 60 1937443 20240129161854 157.33.72.26 9 93 4845765 20240123180337 152.57.118.92 6 89 4768202 20240112075903 35.214.184.131 6 57 2084716 20240131214636 59.184.239.29 6 82 4434307 20240111185948 152.59.12.107 6 89 4777907 20240111205012 65.154.226.168 4 78 2264836 20240105024859 65.154.226.170 4 78 2264836 20240105023252 101.53.147.36 3 3 56753 20240129000623 128.199.61.251 2 2 390270 20240105233555 49.38.158.129 2 4 67044 20240111153555 157.33.105.148 2 2 91674 20240123224829 205.210.31.32 2 2 390228 20240123185400 198.235.24.193 2 2 415214 20240130033714 167.248.133.182 0 1 41239 165.232.76.155 2 2 390270 20240107072317 138.197.166.39 2 2 91512 20240116155411 167.248.133.187 2 6 436882 20240130081138 138.197.28.177 2 2 82864 20240130100330 104.236.72.63 2 2 91396 20240102162250 139.144.150.23 2 2 390270 20240105221921 185.195.232.153 2 2 91674 20240123074511 138.68.133.118 2 2 390270 20240107063452 199.45.154.16 2 3 95631 20240113221905 199.45.155.34 2 3 95515 20240101120942 198.235.24.202 2 2 390270 20240102121004 199.45.155.16 2 3 95793 20240122102219 176.123.7.11 2 2 91512 20240118045044 157.33.96.230 2 2 91392 20240111193817 184.107.184.22 0 3 218248 117.223.56.69 0 11 2385856 101.68.211.2 2 54 925596 20240103090609 199.45.155.33 2 3 95515 20240104141857 152.57.209.25 2 2 91392 20240111185147 152.59.12.234 2 2 0 20240111205106 52.21.15.185 2 2 20 20240130125318 51.68.11.231 1 1 2554 20240130052417 184.107.184.25 2 2 526826 20240130163250 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 26 20240101 3 4 95515 2 20240102 4 4 481666 2 20240103 3 55 925596 2 20240104 12 13 461099 2 20240105 14 162 5310212 6 20240107 6 6 780540 3 20240110 280 699 18794041 3 20240111 100 606 24068009 13 20240112 87 505 15800703 5 20240113 6 7 148887 4 20240114 1 1 0 1 20240115 44 338 10838322 2 20240116 2 2 91512 1 20240118 204 506 14079460 6 20240119 1 1 0 1 20240120 1 1 0 1 20240122 3 4 95793 2 20240123 151 889 37727064 11 20240124 439 1161 36571844 8 20240125 481 867 11720654 8 20240126 2 2 0 2 20240127 1 1 0 1 20240128 404 954 22032681 5 20240129 15 65 1994196 3 20240130 2673 3501 63442074 13 20240131 1004 1739 20722769 9 END_DAY # Session range - Number of visits BEGIN_SESSION 6 30s-2mn 10 30mn-1h 9 1h+ 19 2mn-5mn 8 5mn-15mn 6 0s-30s 64 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 153 /wp-admin/admin-ajax.php 2239 7454283 4 11 /wp-cron.php 1315 0 47 46 / 417 21504684 45 30 /wp-json/jetpack/v4/jitm 264 10234 0 0 /wp-admin/post.php 134 19449933 0 0 /about/ 82 3457307 0 1 /wp-admin/load-scripts.php 64 4181952 0 0 /wp-json/wp/v2/pages 47 84824 0 0 /wp-json/elementor/v1/globals 42 10626 0 0 /wp-json/elementor/v1/kit-elements-defaults 42 924 0 0 /wp-content/plugins/elementor/assets/lib/font-awesome/webfonts/fa-solid-900.woff2 39 2267684 1 0 /wp-admin/edit.php 39 1733006 0 0 /wp-content/plugins/elementor/assets/lib/font-awesome/webfonts/fa-brands-400.woff2 39 2226156 0 5 /wp-admin/themes.php 37 1249592 0 0 /wp-admin/load-styles.php 35 5508675 0 0 /wp-json/wp/v2/taxonomies 34 105866 0 0 /wp-json/ 32 11328 0 0 /wp-json/wp/v2/users 32 1440 0 0 /wp-json/wp/v2/block-patterns/categories 32 20704 0 0 /wp-admin/admin.php 32 1653690 0 0 /wp-json/wp/v2/blocks 32 704 0 0 /wp-json/wp/v2/block-patterns/patterns 32 1633778 0 0 /wp-json/wp/v2/themes 32 62636 0 0 /wp-content/fonts/open-sans/memSYaGs126MiZpBA-UvWbX2vVnXBbObj2OVZyOOSr4dVJWUgsjZ0B4gaVQUwaEQXjM.woff 32 449696 1 0 /wp-json/wp/v2/wp_pattern_category 32 704 0 0 /department-of-hindi/ 10 449104 0 0 /wp-json/wp/v2/pages/1690 1 2384 0 0 /about-collage/ 18 696568 0 0 /wp-content/plugins/elementor/assets/lib/font-awesome/webfonts/fa-brands-400.ttf 2 268080 0 0 /faculties-2-2/ 2 77226 0 0 /media/ 2 65284 0 0 /wp-admin/post-new.php 19 2028190 0 0 /wp-json/wp/v2/pages/1942 4 7806 0 0 /wp-content/plugins/smart-slider-3/Public/SmartSlider3/Application/Admin/Assets/fonts/Inter-Medium.woff2 1 95256 0 0 /wp-json/wp/v2/pages/1935 3 3746 0 0 /department-of-management/ 2 81770 0 0 /exam-schedule/ 2 65262 0 0 /wp-content/plugins/elementor/assets/lib/font-awesome/webfonts/fa-brands-400.woff 1 90060 0 0 /examination-result-2/ 2 65296 0 1 /wp-json/wp/v2/categories/1 11 3168 0 0 /elementor-hf/footer/ 10 198524 0 0 /wp-admin/ 22 1066039 12 0 /activity/ 2 77200 0 0 /wp-json/wp/v2/pages/1025 5 8749 0 0 /wp-content/fonts/lato/S6u9w4BMUTPHh6UVSwiPGQ.woff2 31 576000 1 2 /teaching-faculties/ 2 65424 0 0 /wp-json/wp/v2/pages/1933 4 7803 0 0 /department-of-english/ 12 476516 0 2 /wp-login.php 4 10094 2 1 /wp-content/plugins/elementor/assets/lib/font-awesome/webfonts/fa-solid-900.woff 1 101652 0 0 /wp-json/wp/v2/pages/1029 2 4768 0 0 /wp-content/themes/bizberg/assets/icons/font-awesome-5/webfonts/fa-brands-400.ttf 2 267976 0 0 /wp-json/wp/v2/pages/1954 3 5431 0 0 /wp-json/wp/v2/posts 3 2652 0 0 /wp-json/wp/v2/pages/6 5 11920 0 0 /collage-development-committees/ 2 65326 1 0 /wp-content/themes/bizberg/assets/icons/font-awesome-5/webfonts/fa-regular-400.woff2 2 26448 0 0 /department-of-commerce/ 24 1058299 0 0 /wp-json/wp/v2/pages/1940 2 3066 0 0 /chairmans-message/ 4 163202 0 1 /wp-json/wp/v2/pages/1950/autosaves 1 303 0 0 /wp-json/wp/v2/pages/1785 1 2384 0 0 /photo-gallery-6/ 2 65330 0 1 /vision-mission/ 2 66172 1 1 /wp-content/plugins/elementor/assets/lib/eicons/fonts/eicons.woff2 16 1049916 0 0 /wp-content/plugins/elementor/assets/lib/font-awesome/webfonts/fa-solid-900.ttf 2 405488 0 0 /wp-admin/theme-install.php 7 249357 0 0 /wp-content/plugins/bellows-accordion-menu/assets/css/fontawesome/fonts/fontawesome-webfont.woff2 9 451248 0 0 /wp-json/wp/v2/pages/1946 2 3043 0 0 /wp-content/fonts/poppins/pxiByp8kv8JHgFVrLGT9Z1xlE92JQEk.woff 20 186696 0 3 /wp-json/wp/v2/pages/1944 2 3051 0 0 /code-of-conduct/ 2 65272 0 0 /wp-json/wp/v2/pages/1938 2 3061 0 0 /wp-content/themes/bizberg/assets/icons/font-awesome-5/webfonts/fa-solid-900.woff 1 101648 0 0 /non-teaching/ 2 65394 0 0 /wp-content/fonts/open-sans/memSYaGs126MiZpBA-UvWbX2vVnXBbObj2OVZyOOSr4dVJWUgsjZ0B4kaVQUwaEQXjN_mQ.woff 4 27276 0 0 /wp-admin/nav-menus.php 27 3626132 0 0 /attainment-of-po-co/ 2 65396 0 0 /wp-admin/plugin-install.php 4 171544 0 0 /student-satisfaction-survey/ 2 65454 0 0 /prospects/ 2 65210 0 0 /alumni/ 6 195726 0 1 /about-4/ 24 1156780 0 0 /bachelor-of-arts/ 4 131060 0 1 /wp-json/wp/v2/media 6 2546 0 0 /wp-admin/upgrade.php 1 21 0 0 /wp-json/wp/v2/pages/1950 2 3086 0 0 /wp-content/fonts/open-sans/memSYaGs126MiZpBA-UvWbX2vVnXBbObj2OVZyOOSr4dVJWUgsjZ0B5OaVQUwaEQXjN_mQ.woff 5 41640 0 0 /wp-admin/plugins.php 7 327254 0 0 /examination-result/ 2 65336 0 0 /wp-json/wp/v2/types/post 2 1792 0 0 /admission-rules/ 2 65410 0 1 /wp-content/themes/bizberg/assets/icons/font-awesome-5/webfonts/fa-brands-400.woff2 3 230208 0 0 /wp-json/wp/v2/pages/1940/autosaves 1 301 0 0 /n-s-s/ 2 65936 0 0 /wp-content/themes/bizberg/assets/icons/font-awesome-5/webfonts/fa-brands-400.woff 1 89988 0 0 /right-to-information-act-rti/ 6 196254 0 0 /faculties-1/ 2 77228 0 1 /wp-content/themes/bizberg/assets/icons/font-awesome-5/webfonts/fa-solid-900.woff2 3 234804 0 0 /wp-json/omapp/v1/notifications 9 6174 0 0 /department-of-history/ 28 1250635 0 0 /elementor-hf/header/ 14 228648 0 0 /departmental-blogs/ 2 77262 0 1 /wp-admin/async-upload.php 17 15233 0 0 /wp-admin/upload.php 7 347669 0 0 /academic-calendar/ 12 408114 0 1 /wp-includes/js/tinymce/skins/lightgray/fonts/tinymce.woff 1 18824 0 0 /wp-content/plugins/header-footer-elementor/assets/fonts/hfe.ttf 18 62784 0 0 /wp-content/plugins/smart-slider-3/Public/SmartSlider3/Application/Admin/Assets/fonts/Inter-SemiBold.woff2 1 95788 0 0 /achievements/ 2 81580 0 0 /wp-json/wp/v2/pages/451 1 2384 0 0 /author/admin/ 2 54354 0 1 /wp-admin/profile.php 1 0 0 0 /admission/ 2 65412 0 0 /faculties-4/ 14 621328 0 1 /wp-admin/update.php 1 28593 0 0 /wp-json/wp/v2/pages/1791 1 2384 0 0 /wp-json/wp/v2/types 2 12840 0 0 /coordinator-4/ 2 65318 0 0 /wp-content/plugins/wpforms-lite/assets/images/integrations/elementor/font/icon-wpforms.woff2 9 18424 0 0 /statutory-committees/ 2 65306 0 0 /wp-json/wp/v2/taxonomies/post_tag 11 9394 0 0 /department-of-marathi/ 18 802354 1 0 /wp-json/wp/v2/templates 2 44 0 0 /wp-content/themes/bizberg/assets/icons/font-awesome-5/webfonts/fa-solid-900.ttf 2 405488 0 0 /alumni-2/ 2 65322 0 0 /2018-19/ 2 65392 0 0 /wp-json/wp/v2/taxonomies/category 11 10054 0 0 /wp-json/wp/v2/widget-types 3 3306 0 0 /about-1/ 14 653468 0 0 /faculties-3/ 14 595806 0 0 /principal/ 2 65378 0 1 /co-po-pso/ 26 924030 0 0 /procedures-and-polices-for-maintaining-and-utilizing-physical-academic-and-support-facilities/ 4 171200 0 1 /wp-json/wp/v2/pages/1025/autosaves 1 888 0 0 /wp-json/wp/v2/pages/879 1 2384 0 0 /faculties-2/ 16 654390 0 0 /wp-json/wp/v2/pages/1948 2 3043 0 0 /wp-json/wp/v2/pages/1952 3 5421 0 0 /wp-content/plugins/elementor/assets/lib/font-awesome/webfonts/fa-regular-400.woff2 6 66380 0 0 /wp-json/wp/v2/media/1854 1 947 0 0 /wp-json/wp/v2/block-directory/search 4 4514 0 0 /wp-content/fonts/open-sans/memSYaGs126MiZpBA-UvWbX2vVnXBbObj2OVZyOOSr4dVJWUgsg-1x4kaVQUwaEQXjN_mQ.woff 4 26328 0 0 /statutory-committee/ 4 130764 0 0 /about-3/ 20 931500 0 0 /staff-list/ 4 130436 0 0 /wp-admin/about.php 21 724169 0 0 /principle-message/ 8 356218 0 0 /wp-content/fonts/open-sans/memSYaGs126MiZpBA-UvWbX2vVnXBbObj2OVZyOOSr4dVJWUgsiH0B4kaVQUwaEQXjN_mQ.woff 4 27132 0 0 /wp-admin/index.php 2 96931 0 0 /wp-admin/customize.php 7 2606383 0 0 /news/ 2 65258 0 1 /rti/ 2 81454 0 0 END_SIDER