AWSTATS DATA FILE 7.9 (build 20230108) # If you remove this file, all statistics for date 202501 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/ssl/awstats.adhyapakmahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2075 POS_TIME 2724 POS_VISITOR 6701 POS_DAY 6800 POS_DOMAIN 3316 POS_LOGIN 3542 POS_ROBOT 3697 POS_WORMS 4104 POS_EMAILSENDER 4235 POS_EMAILRECEIVER 4378 POS_SESSION 6879 POS_FILESIZE 7077 POS_SIDER 7016 POS_FILETYPES 4513 POS_DOWNLOADS 4595 POS_OS 4792 POS_BROWSER 4880 POS_SCREENSIZE 4954 POS_UNKNOWNREFERER 5028 POS_UNKNOWNREFERERBROWSER 5115 POS_ORIGIN 5197 POS_SEREFERRALS 5327 POS_PAGEREFS 5471 POS_SEARCHWORDS 5619 POS_KEYWORDS 5771 POS_MISC 2388 POS_ERRORS 5830 POS_CLUSTER 3398 POS_SIDER_404 5953 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20250201062716 5 1146 18706073943422 FirstTime 0 LastTime 0 LastUpdate 20250201183642 5 0 4 0 0 TotalVisits 0 TotalUnique 0 MonthHostsKnown 0 MonthHostsUnknown 1 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 AddToFavourites 0 2 0 JavaEnabled 0 0 0 PDFSupport 0 0 0 QuickTimeSupport 0 0 0 JavascriptDisabled 0 0 0 TotalMisc 0 0 0 WindowsMediaPlayerSupport 0 0 0 RealPlayerSupport 0 0 0 FlashSupport 0 0 0 DirectorSupport 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 0 0 0 4 9 37427 1 0 0 0 45 45 471627 2 0 0 0 2 3 18956 3 0 0 0 9 13 666 4 0 1 1832037 117 118 1433837 5 0 0 0 0 0 0 6 0 0 0 4 4 0 7 0 0 0 78 78 977625 8 0 0 0 41 41 471627 9 0 0 0 8 12 220 10 0 0 0 10 19 74619 11 0 0 0 4 5 705 12 0 0 0 2 7 1869239 13 0 0 0 6 6 940 14 0 0 0 2 2 0 15 0 0 0 12 23 3308940 16 0 0 0 10 21 1963274 17 0 0 0 6 12 1365307 18 0 0 0 74 74 940653 19 0 0 0 2 2 0 20 0 0 0 4 9 55678 21 0 0 0 41 46 469013 22 0 0 0 0 0 0 23 0 0 0 80 82 943474 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 1 us 0 1 1832037 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 7 Go\-http\-client/ 48 15000 20250130235001 0 bingbot/ 40 7150 20250131211751 18 bot[\s_+:,\.\;\/\\-] 10 6393978 20250115230912 6 Googlebot/ 6 660 20250127151157 6 facebookexternalhit/ 4 450 20250131171732 4 YandexBot/ 3 1832267 20250126122726 2 unknown 2 220 20250120095503 2 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 1 pdf 1 1832037 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 3 /sitemap.xml.gz 6 0 1410 /wp-content/uploads/2024/02/migrationform.pdf 4 0 7328148 /wp-content/uploads/2024/02/B.Ed-Syllabus-2017-18.pdf 2 0 2729244 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 1 androidmarshmallow 1 0 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 1 chrome132.0.6834.83 1 0 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 0 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 0 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 0 1 From1 0 0 From2 0 0 From3 0 0 From4 0 0 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 4 301 144 0 302 18 0 406 13 2938 404 341 6151164 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 19 /actuator/env 24 - /ecp/Current/exporttool/microsoft.exchange.ediscovery.exporttool.application 24 - /.DS_Store 24 - /sitemap.txt 4 - /sitemap.xml.gz 9 - /s/730323e2834323e20313e2631323/_/ 24 - /_all_dbs 24 - /sitemaps.xml 4 - /ads.txt 6 - /.vscode/sftp.json 12 - /v2/_catalog 24 - /debug/default/view 24 - /server 24 - /.git/config 26 - /info.php 24 - /telescope/requests 24 - /login.action 24 - /config.json 12 - /sitemap_index.xml 4 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 1 66.249.79.203 0 1 1832037 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 1 20250121 0 1 1832037 0 END_DAY # Session range - Number of visits BEGIN_SESSION 0 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 0 END_SIDER # Payload Range - Payload Frequency BEGIN_FILESIZE 3 5K+ 144 100-500 70 0-44 102 END_FILESIZE