AWSTATS DATA FILE 7.9 (build 20230108) # If you remove this file, all statistics for date 202501 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/ssl/awstats.testsahyadrimahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2079 POS_TIME 2726 POS_VISITOR 8191 POS_DAY 8578 POS_DOMAIN 3420 POS_LOGIN 3661 POS_ROBOT 3816 POS_WORMS 4230 POS_EMAILSENDER 4361 POS_EMAILRECEIVER 4504 POS_SESSION 8898 POS_FILESIZE 9096 POS_SIDER 9035 POS_FILETYPES 4639 POS_DOWNLOADS 4738 POS_OS 5556 POS_BROWSER 5692 POS_SCREENSIZE 5856 POS_UNKNOWNREFERER 5930 POS_UNKNOWNREFERERBROWSER 6271 POS_ORIGIN 6353 POS_SEREFERRALS 6484 POS_PAGEREFS 6647 POS_SEARCHWORDS 6795 POS_KEYWORDS 6947 POS_MISC 2389 POS_ERRORS 7006 POS_CLUSTER 3517 POS_SIDER_404 7130 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20250201005552 1 0 19517521528713 FirstTime 0 LastTime 0 LastUpdate 20250201183638 1 0 0 0 0 TotalVisits 0 TotalUnique 0 MonthHostsKnown 0 MonthHostsUnknown 12 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 AddToFavourites 0 16 0 JavascriptDisabled 0 0 0 TotalMisc 0 0 0 WindowsMediaPlayerSupport 0 0 0 PDFSupport 0 0 0 DirectorSupport 0 0 0 FlashSupport 0 0 0 QuickTimeSupport 0 0 0 JavaEnabled 0 0 0 RealPlayerSupport 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 0 2 228729 145 154 4560584 1 0 0 0 80 81 2108325 2 0 2 962942 0 14 168153 3 0 0 0 2 5 472 4 0 2 228729 1 13 209942 5 0 0 0 10 37 3486184 6 0 0 0 4 6 83856 7 0 3 504199 115 121 3264088 8 0 3 1837393 6 11 718 9 0 0 0 51 63 1129882 10 0 1 32429 8 15 569170 11 0 0 0 44 67 9078186 12 0 0 0 45 51 1110392 13 0 0 0 4 15 285550 14 0 0 0 82 98 6874876 15 0 0 0 6 14 126097 16 0 2 1795378 113 130 3385325 17 0 0 0 8 11 1879214 18 0 0 0 8 11 402619 19 0 0 0 87 104 6102580 20 0 1 42015 39 41 1071073 21 0 0 0 137 148 5500107 22 0 0 0 86 88 2417097 23 0 1 65253 49 61 1205142 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 2 in 0 3 972133 us 0 14 4724934 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 7 Go\-http\-client/ 100 32700 20250130203718 0 Googlebot/ 83 5789012 20250130134823 56 bot[\s_+:,\.\;\/\\-] 29 3673470 20250127111215 10 facebookexternalhit/ 27 17057115 20250126142401 8 bingbot/ 17 91484 20250120215922 12 crawl 4 2912 20250124052807 0 unknown 4 492 20250106194130 4 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 2 pdf 16 5664638 0 0 jpg 1 32429 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 11 /wp-content/uploads/2024/01/Information-Handbook-of-RTI.pdf 27 0 24237603 /wp-content/uploads/2024/01/Tejasvi-Bhandari-madam-FACULTY-PROFILE.pdf 15 0 2494275 /wp-content/uploads/2024/01/Department-of-English-CO.pdf 8 0 3217336 /wp-content/uploads/2024/01/Faculty-Profile.pdf 7 0 294105 /wp-content/uploads/2024/01/Academic-Calender-2018-19.pdf 5 0 326265 /wp-content/uploads/2024/02/Marathi-Dr-Dipti-Shembekar-FACULTY-PROFILE.pdf 4 0 675828 /wp-content/uploads/2024/01/Academic-Calender-2020-21.pdf 3 0 187332 /wp-content/uploads/2024/01/Academic-Calender-2021-22.pdf 2 0 144142 /wp-content/uploads/2024/01/Academic-Calender-2022-23.pdf 2 0 154762 /wp-content/uploads/2024/01/Academic-Calender-2019-20.pdf 1 0 71393 /wp-content/uploads/2024/01/Kadam-P.A.pdf 1 0 282406 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 5 androidmarshmallow 9 0 Unknown 4 0 android10 1 0 android 1 0 win10 2 0 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 5 chrome131.0.6778.139 6 0 chrome131.0.6778.264 4 0 chrome132.0.6834.83 3 0 chrome132.0.0.0 1 0 chrome131.0.0.0 3 0 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 2 Mozilla/5.0_AppleWebKit/537.36_(KHTML,_like_Gecko;_compatible;_GoogleOther)_Chrome/131.0.6778.139_Safari/537.36 20250104002540 Mozilla/5.0_AppleWebKit/537.36_(KHTML,_like_Gecko;_compatible;_GoogleOther)_Chrome/131.0.6778.264_Safari/537.36 20250113022908 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 0 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 0 13 From1 0 0 From2 0 1 From3 0 0 From4 0 3 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 1 www_google_com 0 1 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 4 404 707 28350299 301 272 0 406 98 22148 302 2 0 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 33 /s/730323e2834323e20313e2631323/_/ 50 - /env 2 - /sitemap 2 - /admin/.env 2 - /.git/config 56 - /wp-admin.php 1 - /debug/default/view 50 - /server 50 - /v2/_catalog 50 - /www.testsahyadrimahavidyalay/env 2 - /ptechinstitute/actuator/env 2 - /sitemap_index.xml 4 - /_all_dbs 50 - /sitemaps.xml 4 - /ptechinstitute/env 2 - /www.testsahyadrimahavidyalay/actuator/env 2 - /admin/actuator/env 2 - /sitemap.txt 4 - /config.json 25 - /api/env 2 - /actuator/env 52 - /api/actuator/env 2 - /admin/env 2 - /config/env 2 - /.DS_Store 50 - /login.action 50 - /ads.txt 8 - /info.php 50 - /config/actuator/env 2 - /ecp/Current/exporttool/microsoft.exchange.ediscovery.exporttool.application 50 - /.vscode/sftp.json 25 - /telescope/requests 50 - /sitemap.xml.gz 2 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 12 66.249.66.169 0 1 897689 152.58.14.127 0 1 897689 66.249.79.162 0 2 234210 103.176.135.78 0 1 32429 117.223.114.237 0 1 42015 66.249.79.163 0 3 190141 66.249.79.206 0 2 1063974 66.249.79.37 0 1 42015 66.249.79.100 0 2 1063974 66.249.79.205 0 1 166285 66.249.68.68 0 1 168957 123.108.201.101 0 1 897689 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 12 20250103 0 1 65253 0 20250104 0 4 232156 0 20250108 0 1 42015 0 20250109 0 1 166285 0 20250112 0 2 1795378 0 20250113 0 1 897689 0 20250116 0 1 168957 0 20250117 0 1 168957 0 20250120 0 1 166285 0 20250121 0 1 166285 0 20250127 0 1 32429 0 20250130 0 2 1795378 0 END_DAY # Session range - Number of visits BEGIN_SESSION 0 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 0 END_SIDER # Payload Range - Payload Frequency BEGIN_FILESIZE 5 100-500 108 5K+ 330 2K-5K 1 500-1K 4 0-44 137 END_FILESIZE