AWSTATS DATA FILE 7.8 (build 20200416) # If you remove this file, all statistics for date 202402 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/ssl/awstats.adhyapakmahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2041 POS_TIME 2714 POS_VISITOR 8312 POS_DAY 10049 POS_DOMAIN 3379 POS_LOGIN 3732 POS_ROBOT 3887 POS_WORMS 4137 POS_EMAILSENDER 4268 POS_EMAILRECEIVER 4411 POS_SESSION 10396 POS_SIDER 10591 POS_FILETYPES 4546 POS_DOWNLOADS 4866 POS_OS 5038 POS_BROWSER 5246 POS_SCREENSIZE 5801 POS_UNKNOWNREFERER 5875 POS_UNKNOWNREFERERBROWSER 6548 POS_ORIGIN 7029 POS_SEREFERRALS 7171 POS_PAGEREFS 7315 POS_SEARCHWORDS 7506 POS_KEYWORDS 7658 POS_MISC 2377 POS_ERRORS 7717 POS_CLUSTER 3588 POS_SIDER_404 7880 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20240301023338 1 0 29532578735119 FirstTime 20240215102956 LastTime 20240227102049 LastUpdate 20240301181428 1 0 0 0 0 TotalVisits 61 TotalUnique 39 MonthHostsKnown 0 MonthHostsUnknown 42 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 QuickTimeSupport 0 0 0 TotalMisc 0 0 0 JavaEnabled 0 0 0 JavascriptDisabled 0 0 0 AddToFavourites 0 61 0 WindowsMediaPlayerSupport 0 0 0 DirectorSupport 0 0 0 PDFSupport 0 0 0 RealPlayerSupport 0 0 0 FlashSupport 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 14 14 78124 0 101 11457 1 2 2 39062 0 0 0 2 2 2 147052 0 0 0 3 2 2 39062 0 0 0 4 0 0 0 0 0 0 5 5 55 2384264 0 2 0 6 0 0 0 0 0 0 7 6 6 117186 0 0 0 8 0 0 0 0 0 0 9 2 49 2039080 0 0 0 10 393 910 22566870 25 37 33314 11 761 946 14971862 26 32 0 12 734 961 14254981 9 23 0 13 206 292 5745790 20 30 350338 14 24 24 78756 2 2 225570 15 12 121 165913 2 4 0 16 225 708 17767584 9 105 1816 17 179 547 12592480 14 20 39062 18 14 14 626 2 2 225570 19 8 107 4508142 0 4 0 20 2 39 1133917 0 0 0 21 0 0 0 0 0 0 22 1 1 0 1 1 0 23 9 9 156248 2 5 43181 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 9 in 2033 3915 82276925 us 540 831 13411704 ca 14 14 862430 fr 4 4 294104 gb 4 4 129422 be 2 2 39062 cn 2 2 39062 iq 1 18 865072 au 1 19 869218 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 3 Go\-http\-client/ 16 312472 20240222134335 0 no_user_agent 5 451217 20240226142130 0 scanner 5 82243 20240215234813 0 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 13 svg 60 331022 0 0 Unknown 728 2877831 0 0 css 530 3398977 0 0 png 149 12705304 0 0 woff2 20 1120016 0 0 jpg 49 6408854 0 0 ttf 8 31392 0 0 html 263 5503353 0 0 gif 13 86900 0 0 pdf 2 3196659 0 0 js 1405 33346360 0 0 woff 2 37648 0 0 php 1580 29742683 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 2 /wp-content/uploads/2024/02/migrationform.pdf 1 0 1832037 /wp-content/uploads/2024/02/B.Ed-Syllabus-2017-18.pdf 1 0 1364622 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 10 android 92 6 ios_iphone 57 4 android10 104 4 macosx9 2 2 linuxubuntu 24 6 linux 26 26 win10 3983 2035 macosx15 2 2 win8.1 2 2 Unknown 517 514 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 25 chrome106.0.5249.126 51 2 iphone 18 0 chrome90.0.4430.93 2 2 safari15.2 2 2 chrome117.0.5938.132 47 0 chrome99.0.4844.84 1 0 chrome122.0.0.0 2003 1117 chrome103.0.5060.114 2 2 chrome108.0.0.0 8 8 mozilla 11 8 firefox120.0 16 16 firefox83.0 2 2 chrome115.0.0.0 39 2 chrome37.0.2049.0 2 2 chrome87.0.4280.141 52 2 firefox88.0 2 2 chrome103.0.5060.66 18 0 Unknown 506 506 chrome63.0.3239.108 2 2 chrome33.0.1750.152 2 2 safari 37 2 firefox115.0 4 4 safari15.1 2 2 firefox122.0 20 2 chrome121.0.0.0 1960 914 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 5 WhatsApp/2.23.20.0 20240215144907 Mozilla/5.0_(compatible;_CensysInspect/1.1;__https://about.censys.io/) 20240224133407 Mozilla/5.0_(compatible;_InternetMeasurement/1.0;__https://internet-measurement.com/) 20240217012733 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20240227100402 WordPress/6.4.3;_https://adhyapakmahavidyalay.ptechinstitute.com 20240224184618 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 3 WhatsApp/2.23.20.0 20240215144907 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20240227100402 WordPress/6.4.3;_https://adhyapakmahavidyalay.ptechinstitute.com 20240224184618 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 578 599 From1 0 0 From2 0 0 From3 27 27 From4 1996 4183 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 1 https://md-in-74.webhostbox.net:2083 27 27 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 8 206 2 37866 302 70 32296 404 1 11231 201 2 1795 301 201 0 406 1 226 403 2 941 400 1 21 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 1 /static/admin/javascript/hetong.js 1 https://www.adhyapakmahavidyalay.ptechinstitute.com/static/admin/javascript/hetong.js END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 42 115.96.208.162 2027 3808 77680272 20240225172622 216.10.248.154 496 496 397173 20240224184618 54.247.57.72 6 25 914857 20240215104456 103.176.135.77 4 55 2325935 20240223133008 159.89.53.85 2 2 39062 20240216075023 104.166.80.228 2 2 39062 20240216133848 152.57.0.224 2 51 2231868 20240215193442 198.235.24.205 2 2 225570 20240227100402 167.172.241.166 2 2 39062 20240218074048 103.176.135.74 2 52 2270718 20240215161644 152.58.18.7 2 39 1133917 20240215200120 52.53.152.204 2 2 39062 20240221161549 47.254.74.59 2 2 39062 20240216000400 199.45.155.18 2 3 58305 20240224130355 198.235.24.177 2 2 225570 20240224133644 198.235.24.215 2 2 147052 20240221022817 198.235.24.50 2 2 147052 20240223055814 104.166.80.66 2 2 39062 20240221134215 47.242.224.70 2 2 39062 20240216070725 104.166.80.134 2 2 39062 20240222134503 183.129.153.157 2 2 39062 20240217033223 104.166.80.222 2 2 39038 20240215134610 188.165.87.111 2 2 147052 20240218092800 167.248.133.38 2 3 58305 20240224133401 104.166.80.164 2 2 39062 20240218133543 213.188.87.161 1 18 865072 20240215103219 3.236.171.5 2 2 39062 20240217004357 54.224.7.212 0 18 861899 65.154.226.171 0 47 1892028 192.34.56.139 2 2 54190 20240227102049 184.73.118.105 0 18 861899 51.81.167.146 2 2 90360 20240215121734 64.23.189.117 2 2 39062 20240221193539 104.166.80.143 2 2 39062 20240219134120 87.236.176.13 2 2 39062 20240217012733 152.57.223.248 2 52 2237212 20240223050603 104.166.80.215 2 2 39062 20240217133810 119.12.205.70 1 19 869218 20240215103219 104.166.80.220 2 2 39062 20240220133931 162.142.125.214 2 3 43181 20240217152215 152.57.111.26 2 52 2237212 20240215191721 51.254.49.107 2 2 147052 20240218120430 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 12 20240215 963 1791 39164609 16 20240216 17 64 2204524 6 20240217 20 21 199429 7 20240218 8 8 372228 4 20240219 2 2 39062 1 20240220 2 2 39062 1 20240221 17 17 264238 5 20240222 4 4 39062 3 20240223 207 651 17405363 7 20240224 1355 2218 38725472 8 20240225 2 27 54190 1 20240227 4 4 279760 2 END_DAY # Session range - Number of visits BEGIN_SESSION 6 2mn-5mn 1 1h+ 4 30s-2mn 2 30mn-1h 2 0s-30s 49 15mn-30mn 3 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 112 /wp-admin/admin-ajax.php 819 2271908 0 2 /wp-cron.php 477 0 16 16 / 191 4923718 40 42 /wp-json/jetpack/v4/jitm 115 2530 0 0 /wp-admin/post.php 82 11764761 0 0 /wp-json/wp/v2/taxonomies 48 151506 0 0 /wp-admin/post-new.php 47 6024251 0 0 /wp-json/wp/v2/themes 46 98302 0 0 /wp-json/wp/v2/blocks 46 1012 0 0 /wp-json/wp/v2/block-patterns/patterns 46 2298134 0 0 /wp-json/wp/v2/users 46 2070 0 0 /wp-json/wp/v2/wp_pattern_category 46 1012 0 0 /wp-json/ 46 7728 0 0 /wp-json/wp/v2/block-patterns/categories 46 29762 0 0 /wp-json/wp/v2/taxonomies/category 40 36480 0 0 /wp-json/wp/v2/taxonomies/post_tag 39 33267 0 0 /wp-json/wp/v2/categories/1 39 11154 0 0 /wp-admin/edit.php 34 1588411 0 0 /wp-admin/load-scripts.php 30 2084468 0 0 /wp-admin/nav-menus.php 21 1547357 0 0 /wp-admin/load-styles.php 18 2723777 0 0 /wp-json/elementor/v1/send-event 14 336 0 0 /wp-admin/admin.php 11 628628 1 0 /wp-json/elementor/v1/globals 11 2783 0 0 /wp-json/elementor/v1/kit-elements-defaults 11 242 0 0 /wp-json/wp-block-editor/v1/navigation-fallback 1 1107 0 0 /wp-json/wp/v2/pages/117 2 3025 0 0 /wp-json/wp/v2/pages/178 2 3023 0 0 /wp-json/wp/v2/pages/174/autosaves 1 271 0 0 /wp-json/wp/v2/pages/206 4 4330 0 0 /wp-json/wp/v2/pages/144 2 3036 0 0 /wp-json/wp/v2/pages/152 4 6585 0 0 /check_charset.php 1 77 1 0 /wp-json/wp/v2/pages/8 2 3026 0 0 /wp-json/wp/v2/pages/134 2 3037 0 0 /wp-json/wp/v2/pages/128 2 3035 0 0 /wp-admin/theme-install.php 2 55983 0 0 /wp-json/wp/v2/pages/130 2 3034 0 0 /wp-json/wp/v2/pages/110 4 4321 0 0 /wp-content/plugins/header-footer-elementor/assets/fonts/hfe.ttf 8 31392 0 0 /wp-json/wp/v2/pages/140 2 3022 0 0 /wp-content/plugins/smart-slider-3/Public/SmartSlider3/Application/Admin/Assets/fonts/SmartSliderIcons.woff2 1 24592 0 0 /wp-json/wp/v2/pages 2 23383 0 0 /wp-json/wp/v2/pages/106 2 3038 0 0 /wp-json/wp/v2/pages/188 2 3037 0 0 /wp-content/plugins/elementor/assets/lib/font-awesome/webfonts/fa-regular-400.woff2 2 26552 0 0 /wp-login.php 3 6933 0 0 /wp-json/wp/v2/pages/6 6 12544 0 0 /wp-json/wp/v2/pages/182 2 3024 0 0 /wp-json/wp/v2/pages/115 2 3024 0 0 /wp-json/wp/v2/categories 1 288 0 0 /wp-json/wp/v2/pages/104 2 3037 0 0 /wp-content/plugins/optinmonster/assets/fonts/fontawesome-webfont.woff2 1 77160 0 0 /wp-json/wp/v2/pages/162 2 3041 0 0 /wp-json/wp/v2/pages/152/autosaves 1 362 0 0 /wp-json/wp/v2/block-directory/search 6 6139 0 0 /wp-json/wp/v2/pages/158 5 7756 0 0 /wp-json/wp/v2/pages/100 2 3017 0 0 /wp-content/plugins/elementor/assets/lib/font-awesome/webfonts/fa-solid-900.woff2 2 156392 0 0 /wp-content/plugins/wpforms-lite/assets/images/integrations/elementor/font/icon-wpforms.woff2 4 10528 0 0 /wp-json/wp/v2/navigation/4 2 2852 0 0 /wp-json/wp/v2/users/me 3 2394 0 0 /migration-form/ 2 54562 0 0 /wp-admin/plugins.php 6 241655 0 0 /wp-json/wp/v2/menus 1 310 0 0 /wp-json/omapp/v1/notifications/ 1 239 0 0 /wp-json/wp/v2/pages/204 2 3022 0 0 /wp-json/wp/v2/pages/146 2 3023 0 0 /wp-json/wp/v2/pages/176/autosaves 1 288 0 0 /wp-json/wp/v2/types 2 12788 0 0 /wp-content/plugins/elementor/assets/lib/font-awesome/webfonts/fa-brands-400.woff2 2 153528 0 0 /wp-json/wp/v2/pages/201 3 3700 0 0 /contact-us/ 2 19525 0 1 /wp-json/wp/v2/pages/184 2 3041 0 0 /wp-admin/async-upload.php 10 7039 0 0 /wp-admin/themes.php 3 104580 0 0 /wp-includes/js/tinymce/skins/lightgray/fonts/tinymce.woff 2 37648 0 0 /wp-json/wp/v2/navigation 3 4472 0 0 /wp-json/wp/v2/pages/164 2 3026 0 0 /wp-json/wp/v2/pages/113 2 3037 0 0 /wp-admin/plugin-install.php 4 121409 0 0 /wp-json/wp/v2/pages/102 2 3024 0 0 /wp-json/wp/v2/pages/160 2 3029 0 0 /elementor-hf/header/ 10 131724 0 0 /wp-content/plugins/elementor/assets/lib/eicons/fonts/eicons.woff2 5 384432 0 0 /wp-json/wp/v2/pages/180 2 3017 0 0 /wp-json/wp/v2/posts/1 1 2719 0 0 /wp-json/wp/v2/pages/174 2 3037 0 0 /wp-json/wp/v2/pages/156 2 3033 0 0 /wp-json/wp/v2/pages/142/autosaves 1 271 0 0 /wp-json/wp/v2/media 6 2558 0 0 /wp-content/plugins/smart-slider-3/Public/SmartSlider3/Application/Admin/Assets/fonts/Inter-SemiBold.woff2 2 191576 0 0 /wp-json/wp/v2/media/228 1 912 0 0 /wp-json/wp/v2/posts 5 3550 0 0 /wp-admin/customize.php 2 251796 0 0 /wp-admin/ 5 229539 3 0 /wp-json/wp/v2/pages/209 2 3043 0 0 /wp-json/wp/v2/pages/142 2 3027 0 0 /wp-json/wp/v2/pages/176 2 3050 0 0 /wp-json/wp/v2/pages/154 2 3034 0 0 /wp-json/wp/v2/pages/132 2 3032 0 0 /wp-json/wp/v2/pages/190 2 3034 0 0 /wp-json/wp/v2/pages/186 2 3046 0 0 /wp-content/plugins/smart-slider-3/Public/SmartSlider3/Application/Admin/Assets/fonts/Inter-Medium.woff2 1 95256 0 0 /wp-json/wp/v2/pages/108 2 3038 0 0 /elementor-hf/footer/ 2 26488 0 0 /wp-json/omapp/v1/notifications 1 239 0 0 /wp-json/wp/v2/media/230 1 883 0 0 /wp-json/wp/v2/pages/166 1 2382 0 0 /wp-admin/about.php 10 319650 0 0 /wp-json/wp/v2/types/post 2 1788 0 0 /syllabus/ 4 109830 0 0 END_SIDER