AWSTATS DATA FILE 7.9 (build 20230108) # If you remove this file, all statistics for date 202502 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/ssl/awstats.adhyapakmahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2075 POS_TIME 2733 POS_VISITOR 7150 POS_DAY 7329 POS_DOMAIN 3348 POS_LOGIN 3574 POS_ROBOT 3729 POS_WORMS 4106 POS_EMAILSENDER 4237 POS_EMAILRECEIVER 4380 POS_SESSION 7429 POS_FILESIZE 7650 POS_SIDER 7575 POS_FILETYPES 4515 POS_DOWNLOADS 4614 POS_OS 4812 POS_BROWSER 4892 POS_SCREENSIZE 4959 POS_UNKNOWNREFERER 5033 POS_UNKNOWNREFERERBROWSER 5120 POS_ORIGIN 5202 POS_SEREFERRALS 5332 POS_PAGEREFS 5476 POS_SEARCHWORDS 5624 POS_KEYWORDS 5776 POS_MISC 2397 POS_ERRORS 5835 POS_CLUSTER 3430 POS_SIDER_404 5970 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20250301000637 1 0 7054934991248 FirstTime 0 LastTime 20250211104045 LastUpdate 20250301182839 1 0 0 0 0 TotalVisits 2 TotalUnique 2 MonthHostsKnown 0 MonthHostsUnknown 3 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 PDFSupport 0 0 0 AddToFavourites 0 6 0 TotalMisc 0 0 0 RealPlayerSupport 0 0 0 JavaEnabled 0 0 0 QuickTimeSupport 0 0 0 DirectorSupport 0 0 0 FlashSupport 0 0 0 WindowsMediaPlayerSupport 0 0 0 JavascriptDisabled 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 0 0 0 5 5 226 1 0 0 0 27 29 41094 2 0 0 0 6 14 1851193 3 0 0 0 11 12 235 4 0 0 0 4 7 18956 5 0 0 0 4 10 3238355 6 0 0 0 6 7 705 7 0 0 0 2 2 0 8 0 0 0 2 3 235 9 2 2 40786 72 80 911159 10 2 2 40786 9 16 19372 11 0 0 0 3 3 226 12 0 0 0 39 43 483102 13 0 1 1832037 2 12 37642 14 0 0 0 7 9 446 15 0 0 0 6 11 55678 16 0 0 0 8 11 18486 17 0 0 0 39 39 482412 18 0 0 0 41 43 509069 19 0 0 0 62 63 512736 20 0 0 0 45 49 517003 21 0 0 0 117 120 1441771 22 0 0 0 39 40 490113 23 0 0 0 39 40 472332 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 1 jp 4 5 1913609 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 6 Go\-http\-client/ 44 13216 20250220221653 0 bingbot/ 40 7150 20250228040626 18 bot[\s_+:,\.\;\/\\-] 14 3238545 20250226105948 10 facebookexternalhit/ 4 450 20250209132038 4 YandexBot/ 3 1832267 20250207021224 2 Googlebot/ 2 220 20250221201058 2 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 2 html 4 81572 0 0 pdf 1 1832037 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 3 /sitemap.xml.gz 10 0 2350 /wp-content/uploads/2024/02/migrationform.pdf 3 0 5496111 /wp-content/uploads/2024/02/B.Ed-Syllabus-2017-18.pdf 1 0 1364622 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 1 ios_iphone 5 4 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 1 safari13.0.3 5 4 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 0 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 0 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 4 5 From1 0 0 From2 0 0 From3 0 0 From4 0 0 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 5 301 151 0 404 328 5996616 409 1 1200 302 18 0 406 57 12882 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 40 /login.action 20 - /_all_dbs 24 - /secrets.json 1 - /backup.zip 1 - /.aws/credentials 2 - /ads.txt 4 - /_vti_pvt/administrators.pwd 2 - /actuator/env 20 - /info.php 20 - /server.key 2 - /s/730323e2834323e20313e2631323/_/ 20 - /cloud-config.yml 2 - /docker-compose.yml 2 - /.ssh/id_ecdsa 2 - /phpinfo.php 2 - /_vti_pvt/authors.pwd 2 - /.kube/config 2 - /telescope/requests 20 - /config.yaml 2 - /ecp/Current/exporttool/microsoft.exchange.ediscovery.exporttool.application 20 - /.svn/wc.db 2 - /.git/HEAD 2 - /config/production.json 1 - /server 20 - /_vti_pvt/service.pwd 2 - /.vscode/sftp.json 11 - /.env.production 2 - /user_secrets.yml 2 - /sitemap.xml.gz 12 - /.ssh/id_ed25519 2 - /config.xml 2 - /config.yml 2 - /config.php 2 - /config.json 11 - /.git/config 22 - /.DS_Store 20 - /backup.tar.gz 1 - /v2/_catalog 20 - /config/database.php 2 - /debug/default/view 20 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 3 43.156.168.214 2 2 40786 20250211095341 43.159.141.150 2 2 40786 20250211104045 43.159.144.16 0 1 1832037 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 2 20250210 0 1 1832037 0 20250211 4 4 81572 2 END_DAY # Session range - Number of visits BEGIN_SESSION 1 0s-30s 2 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 1 / 4 81572 2 2 END_SIDER # Payload Range - Payload Frequency BEGIN_FILESIZE 4 1K-2K 1 100-500 157 5K+ 338 0-44 177 END_FILESIZE