AWSTATS DATA FILE 7.9 (build 20230108) # If you remove this file, all statistics for date 202502 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/ssl/awstats.sahyadrimahavidyalaysawarde.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2082 POS_TIME 2757 POS_VISITOR 8302 POS_DAY 9924 POS_DOMAIN 3415 POS_LOGIN 3737 POS_ROBOT 3892 POS_WORMS 4203 POS_EMAILSENDER 4334 POS_EMAILRECEIVER 4477 POS_SESSION 10460 POS_FILESIZE 10697 POS_SIDER 10617 POS_FILETYPES 4612 POS_DOWNLOADS 4730 POS_OS 4778 POS_BROWSER 4978 POS_SCREENSIZE 5287 POS_UNKNOWNREFERER 5361 POS_UNKNOWNREFERERBROWSER 5960 POS_ORIGIN 6327 POS_SEREFERRALS 6461 POS_PAGEREFS 6605 POS_SEARCHWORDS 6753 POS_KEYWORDS 6905 POS_MISC 2421 POS_ERRORS 6964 POS_CLUSTER 3593 POS_SIDER_404 7074 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20250301034100 6 1599 16697110996467 FirstTime 20250201120845 LastTime 20250228190710 LastUpdate 20250301182826 6 0 5 0 0 TotalVisits 42 TotalUnique 37 MonthHostsKnown 0 MonthHostsUnknown 40 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 FlashSupport 0 0 0 JavaEnabled 0 0 0 QuickTimeSupport 0 0 0 WindowsMediaPlayerSupport 0 0 0 RealPlayerSupport 0 0 0 DirectorSupport 0 0 0 AddToFavourites 0 0 0 TotalMisc 0 0 0 PDFSupport 0 0 0 JavascriptDisabled 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 0 0 0 0 0 0 1 0 0 0 4 4 98878 2 2 2 98294 9 21 492415 3 0 0 0 47 111 33512035 4 2 2 98294 0 2 716 5 0 0 0 40 87 34108980 6 6 9 155679 44 49 67019 7 6 9 156926 2 8 28672 8 8 9 323329 3 3 1074 9 4 6 58141 51 71 8464678 10 4 11 169458 9 16 303631 11 8 16 296199 4 6 197304 12 8 11 183635 0 0 0 13 0 0 0 3 3 1074 14 0 0 0 2 2 98294 15 8 10 183144 0 10 3580 16 4 5 198326 0 2 716 17 6 13 267752 0 0 0 18 8 11 114544 10 14 4296 19 8 9 323329 0 0 0 20 6 6 83868 10 40 13220 21 0 0 0 3 3 98520 22 2 3 28447 2 2 98294 23 0 0 0 6 6 294882 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 8 cn 30 60 906320 us 28 36 819834 ca 18 19 814799 ro 6 6 83868 in 4 4 55912 be 2 3 29694 gb 2 3 28447 ru 0 1 491 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 4 bot[\s_+:,\.\;\/\\-] 233 76613305 20250226104621 0 no_user_agent 16 786352 20250224015905 0 curl 8 393176 20250227223815 0 (firefox/)([0-9]\.|[0-1][0]\.) 2 27956 20250222032025 0 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 3 html 90 2383428 0 0 png 24 16772 0 0 js 18 339165 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 0 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 10 Unknown 58 46 win7 6 4 macosx12 2 2 macosx15 30 20 androidoreo 2 2 macos11 24 6 win10 4 4 linuxubuntu 2 2 linux 2 2 androidnougat 2 2 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 12 chrome60.0.3112.107 2 2 chrome100.0.4896.75 4 4 chrome96.0.4664.110 30 20 chrome87.0.4280.88 24 6 mozilla 30 18 chrome71.0.2623.112 4 4 Unknown 28 28 chrome76.0.3809.100 2 2 firefox125.0 2 2 chrome71.0.3578.99 2 2 chrome63.0.3239.132 2 0 chrome126.0.0.0 2 2 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 4 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20250228190231 Mozilla/5.0_(compatible;_InternetMeasurement/1.0;__https://internet-measurement.com/) 20250202094202 Mozilla/5.0_(compatible) 20250228122631 Mozilla/5.0_(compatible;_CensysInspect/1.1;__https://about.censys.io/) 20250222070816 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 1 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20250228190231 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 90 108 From1 0 0 From2 0 0 From3 0 0 From4 0 24 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 3 406 3 678 404 185 66230 409 7 581 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 36 /admin/appsettings.json 2 - /js/main.js 8 - /.git/config 10 - /api/appsettings.Production.json 2 - /config.js 1 - /appointment.php 14 - /vendor/bootstrap/js/bootstrap.bundle.min.js 9 - /appsettings.Production.json 4 - //ajax.googleapis.com/ajax/libs/jquery/3.6.3/jquery.min.js 9 - /message-api/actuator/env 4 - /ads.txt 6 - /vendor/purecounter/purecounter_vanilla.js 8 - /appsettings.json 4 - /config/aws.yml 2 - //maxcdn.bootstrapcdn.com/bootstrap/3.4.1/js/bootstrap.min.js 7 - /env 4 - /admin/actuator/env 4 - /admin/env 4 - /.aws/credentials 2 - /api/appsettings.json 4 - /gateway/env 4 - /api/actuator/env 4 - /vendor/php-email-form/validate.js 8 - /_profiler/phpinfo 2 - /actuator 4 - /api/env 4 - /phpinfo.php 2 - /.git/HEAD 2 - /phpinfo 2 - /gateway/actuator/env 4 - /robots.txt 16 - /aws.yml 2 - /actuator/env 4 - /vendor/glightbox/js/glightbox.min.js 9 - /info.php 2 - /vendor/swiper/swiper-bundle.min.js 8 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 40 123.160.223.74 10 17 197218 20250225063635 194.50.16.252 4 4 55912 20250203205518 123.160.223.73 4 5 56403 20250203065605 115.231.78.12 4 6 198817 20250218160405 111.7.96.173 4 11 169458 20250221113540 111.7.106.106 2 5 31899 20250224172209 159.89.188.66 2 3 28447 20250208124822 111.7.106.107 2 6 137559 20250224172210 123.160.223.72 2 3 28447 20250228190710 103.150.186.126 2 2 27956 20250205091808 205.210.31.3 2 2 98294 20250214114802 198.235.24.168 2 2 98294 20250218125054 167.94.146.48 2 4 30185 20250205181012 205.210.31.94 2 2 98294 20250225080355 147.185.132.70 2 2 98294 20250228073144 54.88.179.33 2 2 27956 20250209181532 128.199.43.121 2 3 28447 20250210153956 147.185.132.219 2 2 98294 20250211041321 205.210.31.155 2 2 98294 20250204190537 87.236.176.119 2 2 27956 20250202094200 147.185.132.96 2 2 98294 20250205021432 167.94.145.105 2 4 30185 20250222070814 146.190.241.202 2 3 28447 20250217110605 198.235.24.255 2 2 98294 20250222083916 205.210.31.255 2 2 98294 20250215165953 87.236.176.230 0 1 1738 147.185.132.117 2 2 98294 20250221194711 147.185.132.231 2 2 98294 20250208174518 35.171.144.152 2 2 27956 20250209181538 185.247.137.247 0 1 491 111.7.96.155 2 3 28447 20250211071329 147.185.132.177 2 2 98294 20250219085643 64.227.71.199 2 3 28447 20250228122628 205.210.31.73 2 2 98294 20250228190231 64.227.142.200 2 3 28447 20250203155052 45.148.10.35 2 2 27956 20250224202820 123.160.223.75 0 4 58072 205.210.31.158 2 2 98294 20250208152555 193.41.206.50 2 2 27956 20250220152312 64.227.189.205 2 3 28447 20250226185152 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 22 20250201 2 3 28447 1 20250202 2 4 30185 1 20250203 8 10 112806 3 20250204 2 2 98294 1 20250205 8 11 184882 4 20250208 10 18 394493 4 20250209 4 4 55912 2 20250210 2 3 28447 1 20250211 4 5 126741 2 20250214 2 2 98294 1 20250215 2 2 98294 1 20250216 2 3 28447 1 20250217 2 3 28447 1 20250218 6 8 297111 3 20250219 2 2 98294 1 20250220 2 2 27956 1 20250221 6 13 267752 2 20250222 4 6 128479 2 20250224 6 13 197414 3 20250225 4 5 126741 2 20250226 2 3 28447 1 20250228 8 10 253482 4 END_DAY # Session range - Number of visits BEGIN_SESSION 2 0s-30s 41 30mn-1h 1 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 1 / 90 2383428 42 42 END_SIDER # Payload Range - Payload Frequency BEGIN_FILESIZE 6 5K+ 330 2K-5K 20 100-500 216 44-100 7 1K-2K 12 500-1K 7 END_FILESIZE