AWSTATS DATA FILE 8.0 (build 20240604) # If you remove this file, all statistics for date 202602 will be lost/reset. # Last config file used to build this data file was /home/ptechvkl/tmp/awstats/ssl/awstats.sahyadrimahavidyalaysawarde.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2118 POS_TIME 2776 POS_VISITOR 6805 POS_DAY 7595 POS_DOMAIN 3304 POS_LOGIN 3586 POS_ROBOT 3741 POS_WORMS 3976 POS_EMAILSENDER 4107 POS_EMAILRECEIVER 4250 POS_SESSION 7904 POS_FILESIZE 8139 POS_REQUESTTIME 8235 POS_SIDER 8061 POS_FILETYPES 4385 POS_DOWNLOADS 4467 POS_OS 4515 POS_BROWSER 4649 POS_SCREENSIZE 4913 POS_UNKNOWNREFERER 4987 POS_UNKNOWNREFERERBROWSER 5417 POS_ORIGIN 5655 POS_SEREFERRALS 5787 POS_PAGEREFS 5931 POS_SEARCHWORDS 6079 POS_KEYWORDS 6231 POS_MISC 2440 POS_ERRORS 6290 POS_CLUSTER 3442 POS_SIDER_404 6375 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20260307102859 1 0 4086605417388 FirstTime 0 LastTime 20260221215419 LastUpdate 20260308081020 1 0 0 0 0 TotalVisits 25 TotalUnique 19 MonthHostsKnown 0 MonthHostsUnknown 19 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 WindowsMediaPlayerSupport 0 0 0 FlashSupport 0 0 0 PDFSupport 0 0 0 JavaEnabled 0 0 0 RealPlayerSupport 0 0 0 TotalMisc 0 0 0 QuickTimeSupport 0 0 0 AddToFavourites 0 0 0 DirectorSupport 0 0 0 JavascriptDisabled 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 1 1 482 3 5 482 1 1 1 482 1 1 0 2 1 1 482 1 1 0 3 4 4 1928 2 3 482 4 0 0 0 1 1 482 5 1 1 482 1 1 0 6 1 1 482 1 2 0 7 3 3 1446 1 1 0 8 1 1 482 0 0 0 9 0 0 0 0 1 0 10 1 1 482 3 6 1446 11 0 0 0 0 0 0 12 0 0 0 0 0 0 13 2 2 964 0 0 0 14 0 0 0 0 0 0 15 0 0 0 1 2 482 16 1 1 482 0 0 0 17 2 2 964 0 1 0 18 4 4 1928 0 0 0 19 3 3 1446 0 1 0 20 1 1 482 0 0 0 21 1 1 482 1 1 0 22 0 0 0 1 2 482 23 1 1 482 0 0 0 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 6 us 15 15 7230 ca 7 7 3374 fi 4 4 1928 zz 1 1 482 be 1 1 482 ru 1 1 482 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 3 curl 4 1928 20260228102930 0 bot[\s_+:,\.\;\/\\-] 2 964 20260209224452 0 survey 2 964 20260213044119 0 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 1 html 29 13978 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 0 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 6 win7 1 1 win10 7 7 macosx15 1 1 macosx13 1 1 linux 2 2 Unknown 17 17 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 11 chrome88.0.4324.111 1 1 chrome122.0.0.0 1 1 chrome90.0.4430.93 1 1 safari14.0.1 1 1 chrome67.0.3396.99 1 1 chrome88.0.4324.41 1 1 chrome136.0.0.0 1 1 mozilla 10 10 chrome134.0.0.0 4 4 firefox142.0 1 1 Unknown 7 7 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 3 Mozilla/5.0_(compatible;_CensysInspect/1.1;__https://about.censys.io/) 20260210033110 Mozilla/5.0_(compatible;_InternetMeasurement/1.0;__https://internet-measurement.com/) 20260208185617 Hello_from_Palo_Alto_Networks,_find_out_more_about_our_scans_in_https://docs-cortex.paloaltonetworks.com/r/1/Cortex-Xpanse/Scanning-activity 20260221215419 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 1 Hello_from_Palo_Alto_Networks,_find_out_more_about_our_scans_in_https://docs-cortex.paloaltonetworks.com/r/1/Cortex-Xpanse/Scanning-activity 20260221215419 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 29 29 From1 0 0 From2 0 0 From3 0 0 From4 0 0 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 1 404 13 0 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 6 /wp-login.php 1 - /robots.txt 3 - /_ignition/execute-solution 2 - /wp-admin/ 1 - /.well-known/security.txt 1 - /.env 5 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 19 81.29.142.100 4 4 1928 20260206013135 204.76.203.25 4 4 1928 20260208195841 162.142.125.123 2 2 964 20260209174541 199.45.155.90 2 2 964 20260204191035 206.168.34.117 2 2 964 20260206181735 162.142.125.127 2 2 964 20260210033110 52.200.134.85 1 1 482 20260204160152 205.210.31.15 1 1 482 20260201085454 205.210.31.255 1 1 482 20260217134823 205.210.31.30 1 1 482 20260203034555 134.209.112.166 1 1 482 20260202065743 198.235.24.149 1 1 482 20260214180147 205.210.31.194 1 1 482 20260210103908 198.235.24.147 1 1 482 20260221215419 23.180.120.131 1 1 482 20260209073535 185.247.137.179 1 1 482 20260207003539 87.236.176.9 1 1 482 20260208185617 35.172.9.70 1 1 482 20260206202142 198.235.24.145 1 1 482 20260203071509 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 13 20260201 1 1 482 1 20260202 1 1 482 1 20260203 2 2 964 2 20260204 5 5 2410 4 20260205 2 2 964 2 20260206 5 5 2410 4 20260207 1 1 482 1 20260208 3 3 1446 3 20260209 3 3 1446 2 20260210 3 3 1446 2 20260214 1 1 482 1 20260217 1 1 482 1 20260221 1 1 482 1 END_DAY # Session range - Number of visits BEGIN_SESSION 2 30s-2mn 1 0s-30s 24 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 1 / 29 13978 25 25 END_SIDER # Payload Range - Payload Frequency BEGIN_FILESIZE 2 0-44 21 100-500 37 END_FILESIZE # Request Time Range - Request Time Frequency BEGIN_REQUESTTIME 0 END_REQUESTTIME