AWSTATS DATA FILE 7.8 (build 20200416) # If you remove this file, all statistics for date 202303 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/ssl/awstats.sahyadrimahavidyalaysawarde.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2048 POS_TIME 2720 POS_VISITOR 5950 POS_DAY 6123 POS_DOMAIN 3218 POS_LOGIN 3466 POS_ROBOT 3621 POS_WORMS 3753 POS_EMAILSENDER 3884 POS_EMAILRECEIVER 4027 POS_SESSION 6200 POS_SIDER 6346 POS_FILETYPES 4162 POS_DOWNLOADS 4257 POS_OS 4305 POS_BROWSER 4392 POS_SCREENSIZE 4497 POS_UNKNOWNREFERER 4571 POS_UNKNOWNREFERERBROWSER 4759 POS_ORIGIN 4841 POS_SEREFERRALS 4971 POS_PAGEREFS 5115 POS_SEARCHWORDS 5263 POS_KEYWORDS 5415 POS_MISC 2384 POS_ERRORS 5474 POS_CLUSTER 3322 POS_SIDER_404 5573 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20230401010307 1 0 15121711307394 FirstTime 20230331134241 LastTime 20230331153721 LastUpdate 20230401180410 1 0 0 0 0 TotalVisits 2 TotalUnique 2 MonthHostsKnown 0 MonthHostsUnknown 3 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 JavaEnabled 0 0 0 JavascriptDisabled 0 0 0 PDFSupport 0 0 0 FlashSupport 0 0 0 TotalMisc 0 0 0 RealPlayerSupport 0 0 0 WindowsMediaPlayerSupport 0 0 0 AddToFavourites 0 0 0 QuickTimeSupport 0 0 0 DirectorSupport 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 0 0 0 0 0 0 1 0 0 0 0 0 0 2 0 0 0 0 0 0 3 0 0 0 0 0 0 4 0 0 0 0 0 0 5 0 0 0 0 0 0 6 0 0 0 0 0 0 7 0 0 0 2 6 2148 8 0 0 0 0 0 0 9 0 0 0 0 0 0 10 0 0 0 0 0 0 11 0 0 0 0 0 0 12 0 0 0 0 0 0 13 1 1 13978 0 0 0 14 0 0 0 0 0 0 15 1 2 14469 0 0 0 16 0 0 0 0 0 0 17 0 0 0 0 0 0 18 0 0 0 0 0 0 19 0 0 0 3 3 1299 20 0 0 0 0 0 0 21 0 0 0 2 2 716 22 0 0 0 10 12 3580 23 0 0 0 0 0 0 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 3 be 1 1 13978 gb 1 1 13978 us 0 1 491 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 0 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 2 png 1 491 0 0 html 2 27956 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 0 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 2 win10 2 1 Unknown 1 1 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 3 chrome110.0.0.0 1 1 chrome95.0.4638.69 1 0 mozilla 1 1 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 1 Mozilla/5.0_(compatible;_InternetMeasurement/1.0;__https://internet-measurement.com/) 20230331153721 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 0 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 2 3 From1 0 0 From2 0 0 From3 0 0 From4 0 0 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 2 403 17 6311 404 4 1432 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 2 /Public/home/js/check.js 2 - /static/admin/javascript/hetong.js 2 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 3 87.236.176.30 1 1 13978 20230331153721 146.70.116.164 1 1 13978 20230331134241 165.22.39.64 0 1 491 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 1 20230331 2 3 28447 2 END_DAY # Session range - Number of visits BEGIN_SESSION 1 0s-30s 2 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 1 / 2 27956 2 2 END_SIDER