AWSTATS DATA FILE 7.8 (build 20200416) # If you remove this file, all statistics for date 202403 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/ssl/awstats.adhyapakmahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2041 POS_TIME 2714 POS_VISITOR 7876 POS_DAY 9073 POS_DOMAIN 3293 POS_LOGIN 3619 POS_ROBOT 3774 POS_WORMS 3977 POS_EMAILSENDER 4108 POS_EMAILRECEIVER 4251 POS_SESSION 9518 POS_SIDER 9708 POS_FILETYPES 4386 POS_DOWNLOADS 4583 POS_OS 4631 POS_BROWSER 4769 POS_SCREENSIZE 5059 POS_UNKNOWNREFERER 5133 POS_UNKNOWNREFERERBROWSER 5984 POS_ORIGIN 6643 POS_SEREFERRALS 6779 POS_PAGEREFS 6923 POS_SEARCHWORDS 7112 POS_KEYWORDS 7264 POS_MISC 2377 POS_ERRORS 7323 POS_CLUSTER 3475 POS_SIDER_404 7470 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20240403184314 1 0 15471313473303 FirstTime 20240301023338 LastTime 20240331065540 LastUpdate 20240404182247 1 0 0 0 0 TotalVisits 36 TotalUnique 27 MonthHostsKnown 0 MonthHostsUnknown 29 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 TotalMisc 0 0 0 JavaEnabled 0 0 0 PDFSupport 0 0 0 WindowsMediaPlayerSupport 0 0 0 JavascriptDisabled 0 0 0 AddToFavourites 0 23 0 QuickTimeSupport 0 0 0 FlashSupport 0 0 0 DirectorSupport 0 0 0 RealPlayerSupport 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 0 0 0 2 2 225570 1 0 0 0 0 0 0 2 2 2 225570 0 0 0 3 5 6 58309 1 3 21 4 49 50 339373 3 5 54260 5 13 13 443108 0 0 0 6 4 4 278872 0 25 18476 7 0 0 0 1 1 226 8 0 0 0 0 0 0 9 0 0 0 0 0 0 10 40 198 8312944 2 8 225644 11 58 656 28076909 1 14 41410 12 2 2 54150 2 2 225644 13 0 0 0 0 0 0 14 2 2 54150 0 0 0 15 2 2 53306 0 0 0 16 0 0 0 0 0 0 17 3 54 2461342 0 2 0 18 0 0 0 0 0 0 19 0 0 0 0 0 0 20 2 2 53302 0 0 0 21 0 0 0 0 0 0 22 0 0 0 0 0 0 23 0 0 0 0 0 0 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 8 us 103 106 1264121 in 62 868 38029208 ca 8 8 902354 ua 2 2 54190 az 2 2 53302 be 2 2 54150 nl 2 2 53306 id 1 1 704 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 2 no_user_agent 6 676858 20240311122444 0 crawl 2 54150 20240314043334 0 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 7 Unknown 2 74 0 0 png 115 13479878 0 0 php 32 637 0 0 html 148 3546361 0 0 jpg 37 5770836 0 0 js 416 16084143 0 0 css 241 1529406 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 0 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 6 Unknown 110 107 win7 1 1 macosx6 2 2 macosx15 6 6 linux 2 2 win10 870 64 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 12 firefox97.0 2 2 chrome121.0.0.0 6 6 chrome104.0.0.0 2 2 chrome109.0.0.0 54 4 chrome89.0.4389.90 1 1 mozilla 9 6 chrome108.0.0.0 2 2 chrome79.0.3945.130 2 2 chrome122.0.0.0 360 20 chrome120.0.0.0 50 0 Unknown 101 101 chrome123.0.0.0 402 36 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 8 WhatsApp/2.23.20.0 20240322110416 Mozilla/5.0_(compatible;_CensysInspect/1.1;__https://about.censys.io/) 20240323111205 WordPress.com;_https://jetpack.wordpress.com 20240314043314 WordPress.com;_https://adhyapakmahavidyalay.ptechinstitute.com 20240314043322 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20240315054002 Jetpack_by_WordPress.com 20240314044318 Mozilla/5.0_(compatible;_InternetMeasurement/1.0;__https://internet-measurement.com/) 20240318104444 WordPress/6.4.3;_https://adhyapakmahavidyalay.ptechinstitute.com 20240323111204 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 6 WordPress.com;_https://adhyapakmahavidyalay.ptechinstitute.com 20240314043322 WhatsApp/2.23.20.0 20240322110416 WordPress.com;_https://jetpack.wordpress.com 20240314043314 WordPress/6.4.3;_https://adhyapakmahavidyalay.ptechinstitute.com 20240323111204 Expanse,_a_Palo_Alto_Networks_company,_searches_across_the_global_IPv4_space_multiple_times_per_day_to_identify_customers'_presences_on_the_Internet._If_you_would_like_to_be_excluded_from_our_scans,_please_send_IP_addresses/domains_to:_scaninfo@paloaltonetworks.com 20240315054002 Jetpack_by_WordPress.com 20240314044318 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 96 121 From1 0 0 From2 0 0 From3 6 6 From4 80 864 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 1 https://md-in-74.webhostbox.net:2083 6 6 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 7 409 1 83 500 1 110 404 1 18476 400 1 21 206 2 41327 301 24 0 406 1 226 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 1 /%5C/adhyapakmahavidyalay.ptechinstitute.com%5C/wp-includes%5C/js%5C/wp-emoji-release.min.js 1 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 29 216.10.248.154 61 61 863242 20240323111204 103.176.135.73 28 90 3520186 20240322110432 192.0.86.183 18 18 7181 20240314043428 60.254.0.18 16 254 10985543 20240323111850 115.110.127.198 10 314 13703215 20240323111843 192.0.115.196 7 7 54909 20240314043328 103.176.135.74 6 107 4939796 20240326101359 95.217.18.177 2 2 54190 20240304100052 174.129.178.163 2 2 54150 20240316113644 199.45.155.16 2 3 58269 20240306044813 146.190.233.35 2 2 54150 20240312125215 188.166.37.52 2 2 53306 20240320154303 87.236.176.237 2 2 54150 20240318104444 198.235.24.226 2 2 225570 20240302101315 109.205.213.18 2 2 53302 20240331065540 199.45.154.66 2 3 58309 20240306032600 205.210.31.90 2 2 225644 20240315054002 147.182.177.88 2 2 53302 20240326202741 104.131.12.155 2 2 54150 20240306144956 60.254.0.1 2 53 2476550 20240316103633 198.235.24.48 2 2 225570 20240305062933 205.210.31.94 2 2 225570 20240301023338 192.0.91.129 2 2 54 20240314043314 36.74.40.137 1 1 704 20240303051545 192.0.86.182 1 1 39 20240314044318 199.45.155.50 0 1 4119 192.0.113.47 1 1 172 20240314043304 192.0.87.64 1 1 2075 20240314043320 49.44.78.71 0 50 2403918 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 17 20240301 2 2 225570 1 20240302 2 2 225570 1 20240303 11 11 217464 2 20240304 2 2 54190 1 20240305 2 2 225570 1 20240306 10 12 170728 5 20240312 2 2 54150 1 20240314 46 46 281104 7 20240315 2 2 225644 1 20240316 14 65 2747300 3 20240318 2 2 54150 1 20240319 3 54 2461342 2 20240320 2 2 53306 1 20240322 41 103 3733394 2 20240323 35 678 29537981 4 20240326 4 4 90570 2 20240331 2 2 53302 1 END_DAY # Session range - Number of visits BEGIN_SESSION 5 15mn-30mn 3 0s-30s 29 2mn-5mn 1 30s-2mn 1 5mn-15mn 2 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 17 / 97 2689023 23 22 /wp-cron.php 25 0 8 5 /programme/ 10 150304 0 1 /about/ 8 138959 0 0 /chairmans-message/ 6 112162 2 2 /xmlrpc.php 5 637 2 2 /management/ 4 63849 0 0 /library/ 4 63808 0 1 /student-satisfaction-survey/ 4 75340 0 0 /vision-and-mission/ 4 63946 0 0 /academic-calendar/ 4 75616 0 1 /wp-json/jetpack/v4/sync/spawn-sync 2 74 0 0 /wp-admin/admin-ajax.php 2 0 0 1 /aqar/ 2 37586 0 0 /contact-us/ 2 37456 0 0 /cultural-event/ 2 37608 0 0 /wp-json/ 1 704 1 1 END_SIDER