AWSTATS DATA FILE 7.8 (build 20200416) # If you remove this file, all statistics for date 202403 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/ssl/awstats.testsahyadrimahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2045 POS_TIME 2720 POS_VISITOR 8541 POS_DAY 10429 POS_DOMAIN 3433 POS_LOGIN 3754 POS_ROBOT 3909 POS_WORMS 4165 POS_EMAILSENDER 4296 POS_EMAILRECEIVER 4439 POS_SESSION 11013 POS_SIDER 11219 POS_FILETYPES 4574 POS_DOWNLOADS 4888 POS_OS 5550 POS_BROWSER 5790 POS_SCREENSIZE 6423 POS_UNKNOWNREFERER 6497 POS_UNKNOWNREFERERBROWSER 6754 POS_ORIGIN 6920 POS_SEREFERRALS 7059 POS_PAGEREFS 7203 POS_SEARCHWORDS 7433 POS_KEYWORDS 7585 POS_MISC 2383 POS_ERRORS 7644 POS_CLUSTER 3610 POS_SIDER_404 7790 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20240401035259 5 872 19070960336513 FirstTime 20240301110911 LastTime 20240323121638 LastUpdate 20240401181426 5 0 4 0 0 TotalVisits 44 TotalUnique 27 MonthHostsKnown 0 MonthHostsUnknown 56 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 JavaEnabled 0 0 0 DirectorSupport 0 0 0 WindowsMediaPlayerSupport 0 0 0 JavascriptDisabled 0 0 0 PDFSupport 0 0 0 TotalMisc 0 0 0 RealPlayerSupport 0 0 0 QuickTimeSupport 0 0 0 FlashSupport 0 0 0 AddToFavourites 0 14 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 0 0 0 2 3 146711 1 0 0 0 6 10 382954 2 2 2 535114 34 38 1696184 3 2 5 425895 1 4 77607 4 0 0 0 4 10 143278 5 0 1 1156 0 1 897689 6 2 5 3520 0 2 149452 7 0 0 0 2 2 0 8 0 0 0 6 6 157548 9 2 4 84686 6 10 274316 10 8 35 163458 0 2 166 11 56 109 2626533 5 12 307767 12 53 419 23174744 50 62 4142084 13 0 4 916460 0 3 897689 14 6 6 167436 0 5 208285 15 20 96 7052540 7 9 149452 16 43 164 10497535 37 42 2032669 17 159 806 58834853 6 11 690280 18 2 5 390629 4 6 218946 19 0 0 0 6 8 1042803 20 0 0 0 37 40 1032514 21 2 3 83530 39 46 1178745 22 0 1 897689 8 11 142726 23 2 2 113116 4 7 281598 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 8 in 310 1510 96460635 us 46 146 9383855 gb 2 3 1260 al 1 1 720 ge 0 1 1156 nl 0 1 1156 sc 0 4 4624 ru 0 1 1156 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 3 bingbot/ 62 6167206 20240331174850 18 Go\-http\-client/ 26 251694 20240321212116 0 no_user_agent 8 2140456 20240309162828 0 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 13 html 214 9015951 0 0 ttf 40 6521052 0 0 jpg 82 29234564 0 0 jpeg 6 306524 0 0 svg 20 329180 0 0 woff 30 2887272 0 0 png 165 23713712 0 0 php 17 0 0 0 woff2 58 4276824 0 0 js 541 17464364 0 0 webp 17 125810 0 0 css 459 2327071 0 0 pdf 18 9652238 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 9 /wp-content/uploads/2024/01/Information-Handbook-of-RTI.pdf 10 3 9089172 /wp-content/uploads/2024/01/Academic-Calender-2022-23.pdf 9 0 696429 /wp-content/uploads/2024/01/Academic-Calender-2018-19.pdf 8 1 523049 /wp-content/uploads/2024/01/Academic-Calender-2019-20.pdf 8 0 571144 /wp-content/uploads/2024/01/Academic-Calender-2020-21.pdf 6 0 374664 /wp-content/uploads/2024/01/Department-of-English-CO.pdf 5 0 2010835 /wp-content/uploads/2024/01/Academic-Calender-2021-22.pdf 4 0 288284 /wp-content/uploads/2023/09/Faculty-S-Kurane-updated.pdf 3 1 1892060 /wp-content/uploads/2024/01/Faculty-Profile.pdf 1 0 42015 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 12 android10 3 2 androidmarshmallow 6 6 macosx10 1 1 linux 10 3 macosx15 3 0 macosx13 1 0 ios_iphone 2 0 win10 1462 303 androidoreo 86 7 Unknown 37 31 linuxubuntu 2 2 win7 59 4 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 28 chrome110.0.0.0 2 0 chrome108.0.0.0 2 2 chrome88.0.4240.193 5 5 safari16.6 2 0 chrome85.0.4183.102 2 0 chrome117.0.5938.132 4 0 chrome90.0.4430.72 1 1 firefox115.0 59 4 chrome87.0.4280.144 2 0 chrome123.0.0.0 12 6 opera20.0.1396.73172 1 1 chrome122.0.0.0 1342 287 chrome41.0.2272.105 1 1 chrome104.0.0.0 1 0 chrome91.0.4472.88 86 7 safari11.1.1 1 0 chrome79.0.3945.79 1 0 Unknown 27 27 chrome119.0.0.0 2 0 firefox110.0 2 2 chrome52.0.3624.98 6 6 chrome99.0.4844.51 1 0 chrome122.0.6261.111 1 0 chrome114.0.0.0 1 0 mozilla 10 4 firefox120.0 2 0 chrome109.0.0.0 3 0 firefox123.0 93 6 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 2 Mozilla/5.0_(compatible;_CensysInspect/1.1;__https://about.censys.io/) 20240310111445 WordPress/6.4.3;_https://testsahyadrimahavidyalay.ptechinstitute.com 20240314120735 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 1 WordPress/6.4.3;_https://testsahyadrimahavidyalay.ptechinstitute.com 20240314120735 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 51 63 From1 0 0 From2 0 0 From3 12 12 From4 296 1597 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 2 https://md-in-74.webhostbox.net:2083 8 8 https://assessmentonline.naac.gov.in 4 4 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 6 404 156 6634314 302 24 0 206 5 1055653 301 40 0 406 11 1808 409 4 332 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 20 /sitemaps.xml 10 - /.DS_Store 10 - /.git/config 16 - /v2/_catalog 10 - /.vscode/sftp.json 5 - /config.json 7 - /login.action 10 - /sitemap.xml.gz 3 - /s/730323e2834323e20313e2631323/_/ 10 - /author-sitemap.xml 1 - /_all_dbs 10 - /debug/default/view 10 - /telescope/requests 10 - /server 10 - /atom.xml 6 - // 2 - /sitemap_index.xml 8 - /ecp/Current/exporttool/microsoft.exchange.ediscovery.exporttool.application 10 - / 2 - /sitemap.txt 6 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 56 115.96.217.112 88 286 19752995 20240305174753 115.98.232.29 65 320 14703733 20240314164148 111.93.159.50 56 401 29028585 20240314120634 103.176.135.73 44 166 9008385 20240321162405 216.10.248.154 27 27 517128 20240314120735 115.98.233.69 10 10 332188 20240315160723 125.99.249.126 8 112 4664376 20240308161909 115.98.234.182 8 8 332602 20240313153506 152.57.90.254 7 86 6204070 20240310172011 115.96.219.71 6 64 4188987 20240310174143 115.110.127.198 6 86 6472928 20240305173929 103.216.223.204 5 5 1072424 20240314121248 115.96.216.64 4 6 967968 20240312170002 115.96.77.30 2 2 81686 20240313104430 115.98.234.25 2 7 1263396 20240321162429 115.98.234.85 2 2 84300 20240319125334 60.254.0.18 2 21 396995 20240323121638 165.232.76.155 2 2 535114 20240308024853 106.76.70.132 2 2 82374 20240313214952 165.232.101.54 2 2 113116 20240308232425 199.45.155.16 2 5 425895 20240310111442 138.68.86.32 2 2 535114 20240308165308 199.45.154.50 2 5 425895 20240306035529 146.190.63.248 2 2 535114 20240308122511 79.106.1.98 1 1 720 20240302140439 146.70.108.182 0 1 1156 42.111.99.45 0 1 897689 63.246.149.69 0 1 1156 115.96.218.63 0 1 1156 54.165.194.75 0 1 1156 185.202.239.20 0 1 1156 60.254.0.7 0 1 1156 34.72.176.129 0 1 1156 104.166.80.6 0 1 1156 96.9.249.35 0 1 1156 38.100.114.40 0 1 1156 65.154.226.167 0 1 1156 161.35.246.138 0 1 0 104.166.80.207 0 1 1156 218.248.45.194 0 4 1008946 205.169.39.225 0 1 1156 146.70.119.12 1 1 52 20240303185628 152.57.65.57 0 1 77381 3.89.242.11 0 1 1156 103.181.217.62 0 1 897689 165.231.253.254 0 4 4624 91.239.206.191 0 1 1156 146.70.119.44 1 1 52 20240304062625 115.96.216.140 0 1 1156 89.248.171.23 0 1 1156 152.58.32.139 0 1 1156 65.154.226.169 0 1 1156 60.254.0.1 0 1 1156 115.98.233.207 0 3 815098 104.197.69.115 0 1 1156 115.98.235.125 0 4 402667 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 23 20240301 19 106 5132848 4 20240302 2 2 720 2 20240303 2 2 52 2 20240304 2 2 52 2 20240305 148 708 51074156 5 20240306 2 8 429363 1 20240307 0 15 16184 0 20240308 12 70 4059738 5 20240309 8 61 3185488 1 20240310 15 154 10898383 3 20240311 0 1 897689 0 20240312 26 54 2478860 4 20240313 20 20 829264 4 20240314 85 404 20936572 6 20240315 10 10 332188 1 20240316 0 1 1156 0 20240319 2 2 84300 1 20240320 0 9 1303226 0 20240321 4 10 2245097 2 20240323 2 21 396995 1 20240325 0 2 1262740 0 20240326 0 4 402667 0 20240330 0 1 1156 0 END_DAY # Session range - Number of visits BEGIN_SESSION 7 30mn-1h 4 5mn-15mn 2 0s-30s 30 15mn-30mn 3 1h+ 1 30s-2mn 2 2mn-5mn 2 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 29 /about/ 72 1398794 9 5 / 40 4212522 12 10 /wp-content/plugins/elementor/assets/lib/font-awesome/webfonts/fa-solid-900.woff2 30 2267684 2 1 /wp-content/plugins/elementor/assets/lib/font-awesome/webfonts/fa-brands-400.woff2 27 1995864 0 4 /about-collage/ 26 658294 5 4 /wp-content/plugins/elementor/assets/lib/font-awesome/webfonts/fa-solid-900.ttf 21 3974292 0 0 /wp-content/plugins/elementor/assets/lib/font-awesome/webfonts/fa-brands-400.ttf 19 2546760 0 2 /wp-cron.php 17 0 7 6 /wp-content/plugins/elementor/assets/lib/font-awesome/webfonts/fa-solid-900.woff 16 1626432 0 0 /wp-content/plugins/elementor/assets/lib/font-awesome/webfonts/fa-brands-400.woff 14 1260840 0 1 /about-3/ 12 424621 1 2 /about-1/ 12 495336 0 3 /about-4/ 12 418076 4 0 /admission-rules/ 6 154760 0 0 /vision-mission/ 6 239022 0 0 /right-to-information-act-rti/ 6 231894 3 1 /library/ 2 79624 0 0 /academics/ 2 77274 0 0 /alumni/ 2 77148 0 1 /alumni-2/ 2 77210 0 0 /faculties-2/ 2 80980 0 1 /media/ 2 77166 0 0 /student-feedback/ 2 77416 0 0 /co-po-pso/ 2 78564 0 0 /bachelor-of-arts/ 2 78480 0 0 /wp-content/plugins/elementor/assets/lib/font-awesome/webfonts/fa-regular-400.woff2 1 13276 0 0 /wp-json/ 1 720 1 1 //wp-json/wp/v2/users/ 1 720 0 1 /principal/ 2 77330 0 1 END_SIDER