AWSTATS DATA FILE 7.9 (build 20230108) # If you remove this file, all statistics for date 202503 will be lost/reset. # Last config file used to build this data file was /home3/ptechvkl/tmp/awstats/ssl/awstats.adhyapakmahavidyalay.ptechinstitute.com.conf. # Position (offset in bytes) in this file for beginning of each section for # direct I/O access. If you made changes somewhere in this file, you should # also remove completely the MAP section (AWStats will rewrite it at next # update). BEGIN_MAP 28 POS_GENERAL 2075 POS_TIME 2722 POS_VISITOR 6304 POS_DAY 6430 POS_DOMAIN 3325 POS_LOGIN 3566 POS_ROBOT 3721 POS_WORMS 4008 POS_EMAILSENDER 4139 POS_EMAILRECEIVER 4282 POS_SESSION 6532 POS_FILESIZE 6730 POS_SIDER 6669 POS_FILETYPES 4417 POS_DOWNLOADS 4499 POS_OS 4697 POS_BROWSER 4795 POS_SCREENSIZE 4890 POS_UNKNOWNREFERER 4964 POS_UNKNOWNREFERERBROWSER 5051 POS_ORIGIN 5133 POS_SEREFERRALS 5263 POS_PAGEREFS 5407 POS_SEARCHWORDS 5555 POS_KEYWORDS 5707 POS_MISC 2386 POS_ERRORS 5766 POS_CLUSTER 3422 POS_SIDER_404 5888 END_MAP # LastLine = Date of last record processed - Last record line number in last log - Last record offset in last log - Last record signature value # FirstTime = Date of first visit for history file # LastTime = Date of last visit for history file # LastUpdate = Date of last update - Nb of parsed records - Nb of parsed old records - Nb of parsed new records - Nb of parsed corrupted - Nb of parsed dropped # TotalVisits = Number of visits # TotalUnique = Number of unique visitors # MonthHostsKnown = Number of hosts known # MonthHostsUnKnown = Number of hosts unknown BEGIN_GENERAL 8 LastLine 20250401010849 5 616 9378025345696 FirstTime 0 LastTime 0 LastUpdate 20250401184145 5 0 4 0 0 TotalVisits 0 TotalUnique 0 MonthHostsKnown 0 MonthHostsUnknown 2 END_GENERAL # Misc ID - Pages - Hits - Bandwidth BEGIN_MISC 10 JavaEnabled 0 0 0 JavascriptDisabled 0 0 0 AddToFavourites 0 4 0 FlashSupport 0 0 0 WindowsMediaPlayerSupport 0 0 0 TotalMisc 0 0 0 RealPlayerSupport 0 0 0 QuickTimeSupport 0 0 0 DirectorSupport 0 0 0 PDFSupport 0 0 0 END_MISC # Hour - Pages - Hits - Bandwidth - Not viewed Pages - Not viewed Hits - Not viewed Bandwidth BEGIN_TIME 24 0 0 0 0 23 25 30559 1 0 1 1832037 8 14 19631 2 0 0 0 2 5 1832267 3 0 0 0 2 2 0 4 0 0 0 0 0 0 5 0 0 0 2 11 56838 6 0 0 0 2 3 18956 7 0 0 0 10 15 37207 8 0 0 0 12 12 0 9 0 0 0 16 22 3197349 10 0 1 1364622 4 10 18941 11 0 0 0 2 2 0 12 0 0 0 2 4 36972 13 0 0 0 25 29 49030 14 0 0 0 2 9 37647 15 0 0 0 26 34 67957 16 0 0 0 25 26 30324 17 0 0 0 6 11 92650 18 0 0 0 8 9 37207 19 0 0 0 33 35 104033 20 0 0 0 23 24 41109 21 0 0 0 27 33 86222 22 0 0 0 25 25 67061 23 0 0 0 38 42 161136 END_TIME # Domain - Pages - Hits - Bandwidth # The 25 first Pages must be first (order not required for others) BEGIN_DOMAIN 2 us 0 1 1832037 in 0 1 1364622 END_DOMAIN # Cluster ID - Pages - Hits - Bandwidth BEGIN_CLUSTER 0 END_CLUSTER # Login - Pages - Hits - Bandwidth - Last visit # The 10 first Pages must be first (order not required for others) BEGIN_LOGIN 0 END_LOGIN # Robot ID - Hits - Bandwidth - Last visit - Hits on robots.txt # The 25 first Hits must be first (order not required for others) BEGIN_ROBOT 4 bingbot/ 44 7590 20250324053223 22 bot[\s_+:,\.\;\/\\-] 6 3197099 20250314212403 4 YandexBot/ 5 1832497 20250319150138 4 Googlebot/ 4 440 20250318014032 4 END_ROBOT # Worm ID - Hits - Bandwidth - Last visit # The 5 first Hits must be first (order not required for others) BEGIN_WORMS 0 END_WORMS # EMail - Hits - Bandwidth - Last visit # The 20 first Hits must be first (order not required for others) BEGIN_EMAILSENDER 0 END_EMAILSENDER # EMail - Hits - Bandwidth - Last visit # The 20 first hits must be first (order not required for others) BEGIN_EMAILRECEIVER 0 END_EMAILRECEIVER # Files type - Hits - Bandwidth - Bandwidth without compression - Bandwidth after compression BEGIN_FILETYPES 1 pdf 2 3196659 0 0 END_FILETYPES # Downloads - Hits - Bandwidth BEGIN_DOWNLOADS 3 /sitemap.xml.gz 16 0 3760 /wp-content/uploads/2024/02/migrationform.pdf 3 0 5496111 /wp-content/uploads/2024/02/B.Ed-Syllabus-2017-18.pdf 2 0 2729244 END_DOWNLOADS # OS ID - Hits BEGIN_OS ID - Hits - Pages 2 win10 1 0 androidmarshmallow 1 0 END_OS # Browser ID - Hits - Pages BEGIN_BROWSER 2 chrome133.0.6943.141 1 0 chrome133.0.0.0 1 0 END_BROWSER # Screen size - Hits BEGIN_SCREENSIZE 0 END_SCREENSIZE # Unknown referer OS - Last visit date BEGIN_UNKNOWNREFERER 0 END_UNKNOWNREFERER # Unknown referer Browser - Last visit date BEGIN_UNKNOWNREFERERBROWSER 0 END_UNKNOWNREFERERBROWSER # Origin - Pages - Hits BEGIN_ORIGIN 6 From0 0 1 From1 0 0 From2 0 0 From3 0 0 From4 0 1 From5 0 0 END_ORIGIN # Search engine referers ID - Pages - Hits BEGIN_SEREFERRALS 0 END_SEREFERRALS # External page referers - Pages - Hits # The 25 first Pages must be first (order not required for others) BEGIN_PAGEREFS 0 END_PAGEREFS # Search keyphrases - Number of search # The 10 first number of search must be first (order not required for others) BEGIN_SEARCHWORDS 0 END_SEARCHWORDS # Search keywords - Number of search # The 25 first number of search must be first (order not required for others) BEGIN_KEYWORDS 0 END_KEYWORDS # Errors - Hits - Bandwidth BEGIN_ERRORS 4 301 118 0 404 56 949536 302 6 0 406 159 35934 END_ERRORS # URL with 404 errors - Hits - Last URL referrer BEGIN_SIDER_404 6 /phpinfo.php 2 - /ads.txt 8 - /_profiler/phpinfo 2 - /.git/config 12 - /_all_dbs 18 - /sitemap.xml.gz 14 - END_SIDER_404 # Host - Pages - Hits - Bandwidth - Last visit date - [Start date of last visit] - [Last page of last visit] # [Start date of last visit] and [Last page of last visit] are saved only if session is not finished # The 25 first Hits must be first (order not required for others) BEGIN_VISITOR 2 115.98.234.64 0 1 1364622 66.249.79.103 0 1 1832037 END_VISITOR # Date - Pages - Hits - Bandwidth - Visits BEGIN_DAY 2 20250306 0 1 1364622 0 20250318 0 1 1832037 0 END_DAY # Session range - Number of visits BEGIN_SESSION 0 END_SESSION # URL - Pages - Bandwidth - Entry - Exit # The 25 first Pages must be first (order not required for others) BEGIN_SIDER 0 END_SIDER # Payload Range - Payload Frequency BEGIN_FILESIZE 3 0-44 128 5K+ 61 100-500 215 END_FILESIZE